KEGG   Pocillopora damicornis (lace coral): 113679721
Entry
113679721         CDS       T05773                                 

Name
(RefSeq) beclin-1-like
  KO
K08334  beclin
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04136  Autophagy - other
pdam04137  Mitophagy - animal
pdam04140  Autophagy - animal
pdam04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113679721
   04136 Autophagy - other
    113679721
   04137 Mitophagy - animal
    113679721
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113679721
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pdam04131]
    113679721
   03029 Mitochondrial biogenesis [BR:pdam03029]
    113679721
Membrane trafficking [BR:pdam04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    113679721
Mitochondrial biogenesis [BR:pdam03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    113679721
SSDB
Motif
Pfam: APG6_N APG6 BH3 DUF3450 PI3K_P85_iSH2 FapA
Other DBs
NCBI-GeneID: 113679721
NCBI-ProteinID: XP_027052486
LinkDB
Position
Unknown
AA seq 334 aa
MASAREGRGTTHVGFVCQRCYQPLKLDHSLLSLDEETIAELTAPFPEFAAQTDGGEDTNG
KYDPSSCQTAVNTEGDDTVIRRIISPARLQSLEGGFTLIGDSQPINTENLSHRLKVTSQL
FDIMSGQSTIDHPLCEECTDTLLDQLDQQLKITDDELKDYKVFFEKLNDKPSLDGEALSK
ELEKLRKEEQELIKKLEEIEMERSKVAEKLEAEKERSKQLEIEENKYWMEYSEYQKELLE
SEDEQQRLYRFDQAMVGFLDCLQQFKEAVEKVDKRFCLPYRMEKGKIHDSSGNGGAFSIK
IQFNSEEQWTKALKFVLTNLKWGLAWVSSQFTEK
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggcttctgcaagagaaggcagaggcacaactcatgttggttttgtgtgtcagagatgc
tatcaacccttgaagttggatcattccttgttatctttggacgaggaaacgatcgcagag
cttacagctccatttcctgaatttgcagcccagactgatggtggagaagacacaaatggg
aagtatgacccttcttcatgtcagactgctgtcaatacagagggagatgatacagtcata
aggagaatcatttctcctgcaagacttcagtcactggagggtggttttactctgatcgga
gactcgcagccaattaacacagaaaacctcagtcacaggcttaaggtcactagtcagttg
tttgatataatgtctggacagtcaactattgatcaccctttgtgcgaggagtgtacagac
accttattagaccaactagaccagcagcttaagatcacagatgatgaactcaaagattac
aaagtcttttttgagaagctcaatgacaaaccatctctagacggtgaggccttgtcaaag
gaacttgaaaagcttagaaaggaagagcaagaactgataaagaaattagaggaaattgaa
atggaaagaagcaaagtggctgaaaaacttgaagctgagaaagagagatctaagcagttg
gagattgaggaaaacaagtattggatggaatacagtgagtatcaaaaggagctcttggaa
tctgaagatgagcagcagaggttatacaggtttgatcaagcaatggttggatttttagac
tgtttacaacagtttaaagaagctgttgaaaaagtggacaagaggttttgccttccatac
aggatggaaaaaggcaaaatccatgattcaagtggaaacggcggagctttttccataaaa
attcagttcaactccgaggagcagtggaccaaggcgctaaaattcgtgctgactaacttg
aaatggggactggcgtgggtctcgtcccagtttactgaaaagtga

DBGET integrated database retrieval system