KEGG   Pocillopora damicornis (lace coral): 113685021
Entry
113685021         CDS       T05773                                 

Definition
(RefSeq) protein ERGIC-53-like
  KO
K10080  lectin, mannose-binding 1
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113685021
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pdam04131]
    113685021
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:pdam04091]
    113685021
Membrane trafficking [BR:pdam04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    113685021
Lectins [BR:pdam04091]
 L-type lectins
  113685021
SSDB
Motif
Pfam: Lectin_leg-like Bact_lectin Lectin_legB POPLD DUF5832 DUF1512 Ribosom_S12_S23 DUF4795 Mitofilin
Other DBs
NCBI-GeneID: 113685021
NCBI-ProteinID: XP_027058266
LinkDB
Position
Unknown
AA seq 489 aa
MASVEALTSVGFLLFLFRLSVASVPGERHVKFQYKHSFKGPHLVNKDGAIPFWNHGGSAI
PSDDQIRLTPSMTNKKGYAWTKSTFPHEWWEIEVALKVTGRGRLGGDGVAIWFTETAGIE
GPAFGNTNTWKGLGVFLDSFDNDQQGNNPFISVMLNDGNQIYDHNKDGQDLQRGGCLRDF
RNRPNPVRLRIRYYENVLTVWVHMGMTPKPEDFELCTRLENISLAKNGFFGVSAATGGLA
DDHDVLSFITHSLTPPKDTQGETGMSEEEQKKLAEQYEEYQKKLEQQREEYKTAHPDKVK
KPEAEYESAYERDVRLVYEGQNALHQMISNLHSKVGELTVQVNTLYTLVTTDHNQIGQVV
RHDQTINRQEVNTLINMQQQLSSKLQEISNLMSQGGNMERRDVGDSAGVNSKLSDMQNAI
ESLTHSVNSVATKQQMMSGQEKKECPPPSPMPQCIGPGYFVVLIVAQLIMLIGYIGYKNQ
KEAAAKKFF
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggcttccgtcgaagctttgaccagtgtaggtttcttattgtttttatttcgtttatcc
gtcgcttcagtacctggtgaacgacacgtcaaattccaatataagcatagttttaaagga
ccgcatttagtgaataaagatggagcaattcctttttggaatcacggaggaagtgctatc
cccagcgatgaccagattagattgactccttcaatgactaataaaaaaggttatgcctgg
acaaaaagcacctttcctcatgagtggtgggaaatagaagtagccttgaaagtaactgga
agagggaggcttggtggagatggtgtggccatttggtttacagaaactgcaggcatcgag
ggtcctgcatttggaaatactaacacatggaaaggtcttggtgttttccttgattcattt
gacaatgatcagcagggaaataatccattcatttcagtaatgttaaatgatggaaatcag
atttatgatcataacaaagatggacaggatcttcaacgaggtggctgcttacgagatttt
cgtaatcgaccaaacccagttagacttagaatacgctattatgagaatgtgctcacggtg
tgggtacatatgggaatgacccctaaacctgaagactttgagctctgcactcgtcttgaa
aacataagcctggccaaaaatggcttctttggtgtatctgcagctacaggtggcttagca
gatgaccatgatgttctttcttttattacccactcactcactccacctaaggacacacag
ggtgaaacaggaatgagtgaagaagagcaaaagaagcttgcagagcagtatgaagaatac
caaaagaaactggagcaacaaagagaggagtacaagacagctcaccctgacaaagtcaag
aaacctgaagcagagtatgagagtgcttatgaaagagatgttcgtttggtatatgaagga
caaaatgctcttcatcaaatgatcagcaaccttcactctaaagttggtgaattaacagta
caagtaaatacactatacacattggtaacaacagatcataaccagattggacaagtggtt
agacatgaccaaaccatcaatagacaagaagtgaacacactaataaatatgcaacagcaa
ctcagttctaagctgcaagaaatcagcaacttaatgagtcaaggaggtaatatggagaga
agagatgttggtgactcagctggcgttaattctaaacttagtgacatgcagaatgcaatt
gaatcactaacacactcagtcaatagtgtggcaactaaacaacaaatgatgagtggtcaa
gagaaaaaagaatgcccccctccctcacccatgccacagtgtataggtccaggatacttt
gtggttttaattgtggcccagttaattatgctgattggttacattggatacaaaaatcaa
aaggaggctgctgccaagaaattcttttag

DBGET integrated database retrieval system