KEGG   Pocillopora damicornis (lace coral): 113685540
Entry
113685540         CDS       T05773                                 

Definition
(RefSeq) mitochondrial fission 1 protein-like
  KO
K17969  mitochondrial fission 1 protein
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    113685540
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pdam03029]
    113685540
Mitochondrial biogenesis [BR:pdam03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    113685540
SSDB
Motif
Pfam: Fis1_TPR_C Fis1_TPR_N TPR_2 ANAPC3 TPR_1 TPR_15 TPR_14
Other DBs
NCBI-GeneID: 113685540
NCBI-ProteinID: XP_027058863
LinkDB
Position
Unknown
AA seq 145 aa
MDEILSEGDAKRFEDKYNAEVERGQVSSDTQFSYAWCLIKSSNKSEILKGVLLLQGLCHS
GTDQRDYLYFIAEGYYKLNEYKSALRYTNRLLQIEPENRQGLELHEKITGQMKKDGLIGL
GILGGTALVMGGAAALVGMVFASRK
NT seq 438 nt   +upstreamnt  +downstreamnt
atggatgaaattctttctgaaggagacgcaaagcgttttgaggacaaatataatgctgaa
gttgaaagaggacaggtttcttctgatacccagttcagttatgcttggtgcttgataaaa
agcagcaacaagagtgaaattttaaaaggagttcttctcctgcaaggattatgtcatagt
ggaactgatcaaagagattacctttattttattgcagaaggatattacaaattgaatgaa
tacaagtcagccctcagatacacaaacagattactacaaatagaacctgaaaaccgacag
gggcttgagttgcatgaaaaaatcactggtcaaatgaaaaaagatggcttgattggactt
ggcatcctgggaggtacagctctggttatgggcggagcagcagccttggttgggatggta
tttgcaagccgcaaatga

DBGET integrated database retrieval system