KEGG   Pocillopora damicornis (lace coral): 113685997
Entry
113685997         CDS       T05773                                 

Definition
(RefSeq) serine/threonine-protein kinase NLK-like
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04068  FoxO signaling pathway
pdam04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    113685997
   04068 FoxO signaling pathway
    113685997
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pdam01001]
    113685997
Enzymes [BR:pdam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     113685997
Protein kinases [BR:pdam01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   113685997
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Haspin_kinase ABC1 APH Pkinase_fungal Kinase-like FTA2
Other DBs
NCBI-GeneID: 113685997
NCBI-ProteinID: XP_027059393
LinkDB
Position
Unknown
AA seq 426 aa
MAVCKSRSLMAFPSTHSQQPSTSCHNSHYAPLAQQETQPDKPIGYGAFGVVWSVTDPRNG
KRVALKKMPNVFQSLTSSKRAYRELKMLCFFTHNNVLSALDIVHPGHIDFFQEIHIVSEL
MQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNGNCLLKIC
DFGLARLEEPHESAIMTQEVVTQYYRAPELLAGATNYGQAVDVWSVGCIFAELLSRNILF
QAQSPVQQLNLIIDLLGTPSLDDLCRAGASEGATKYILQKGHKAPALASLYNLSNQATHE
AVHLLCRMLVFDPTQRITCTDALSHPYLDEGRLRFHTCMCSCCHTTSDGRQYVSDFEPVC
QTTFDDSYETNLYTISRVKESLYKFITDRHQNTIPLCINVASPSFRSFQSSGVAPQPEQQ
SSPQLW
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggctgtgtgcaagagccggtctttgatggcgtttccctcgacgcattcccaacaaccg
tcgacgagctgccacaattcacattacgctccgctcgcccaacaagaaacacaaccggac
aaaccaattggttatggagcgttcggcgtagtgtggtctgtgacggatccaagaaatgga
aagagggtcgctttgaagaagatgccgaacgtttttcagagtctcacttcatcgaaaaga
gcctaccgggaacttaagatgttgtgtttcttcacacataacaacgtactctctgctttg
gacatagttcaccctggtcacatagatttcttccaagagatacatatagtttcagaattg
atgcaatcagatttgcacaaaatcattgtatcgccacaaccacttagttcagatcacgtt
aaagttttcctatatcagattctaagaggacttaaatatcttcactctgctgggatattg
catagagacattaaacctggaaatttattagtcaatggcaattgccttttaaaaatatgt
gattttggtcttgctcgtcttgaagaacctcatgaaagtgcaatcatgacacaagaggtt
gttactcagtattacagggcacctgaactgttagctggggctactaactatggtcaagca
gtggatgtgtggtcagtcgggtgcatttttgctgagctcttgagtcgaaatatccttttc
caagcacaaagtcctgttcagcagcttaaccttatcattgatttgttgggaacaccaagt
ttggatgacttatgccgagctggtgccagcgaaggagctactaaatacattcttcagaaa
gggcacaaggcacctgccttagctagtttatataatctctctaatcaagcaacacatgaa
gctgttcatttgctctgtagaatgctggtgtttgaccctacacagcgtataacttgtaca
gatgcattatcccacccttatcttgatgaaggaaggttaagatttcacacgtgtatgtgc
agttgctgtcacacaacatcagatgggcggcagtatgtttcagactttgagcctgtatgc
caaacaacttttgatgattcttatgaaactaatctctacaccatttctcgtgtgaaagag
tctctttacaagtttataacagatcgtcatcagaacaccattcctttgtgtatcaatgta
gcttctccttcttttagaagttttcaaagttctggagtagctccacagccagaacagcag
agttctccccagttgtggtag

DBGET integrated database retrieval system