KEGG   Clostridioides difficile 630Derm: CD630DERM_06600
Entry
CD630DERM_06600   CDS       T03785                                 

Symbol
tcdB
Name
(GenBank) Toxin B
  KO
K11063  toxin A/B
Organism
pdf  Clostridioides difficile 630Derm
Pathway
pdf02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pdf00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CD630DERM_06600 (tcdB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:pdf02042]
    CD630DERM_06600 (tcdB)
Bacterial toxins [BR:pdf02042]
 Type III toxins: Intracellular toxins
  Others
   Toxin A/B
    CD630DERM_06600 (tcdB)
SSDB
Motif
Pfam: TcdA_TcdB_pore TcdA_TcdB Peptidase_C80 Choline_bind_3 Choline_bind_1 TcdB_N MLD Gly_transf_sug
Other DBs
NCBI-ProteinID: CEJ97202
LinkDB
Structure
PDB: 

Position
1:792588..799688
AA seq 2366 aa
MSLVNRKQLEKMANVRFRTQEDEYVAILDALEEYHNMSENTVVEKYLKLKDINSLTDIYI
DTYKKSGRNKALKKFKEYLVTEVLELKNNNLTPVEKNLHFVWIGGQINDTAINYINQWKD
VNSDYNVNVFYDSNAFLINTLKKTVVESAINDTLESFRENLNDPRFDYNKFFRKRMEIIY
DKQKNFINYYKAQREENPELIIDDIVKTYLSNEYSKEIDELNTYIEESLNKITQNSGNDV
RNFEEFKNGESFNLYEQELVERWNLAAASDILRISALKEIGGMYLDVDMLPGIQPDLFES
IEKPSSVTVDFWEMTKLEAIMKYKEYIPEYTSEHFDMLDEEVQSSFESVLASKSDKSEIF
SSLGDMEASPLEVKIAFNSKGIINQGLISVKDSYCSNLIVKQIENRYKILNNSLNPAISE
DNDFNTTTNTFIDSIMAEANADNGRFMMELGKYLRVGFFPDVKTTINLSGPEAYAAAYQD
LLMFKEGSMNIHLIEADLRNFEISKTNISQSTEQEMASLWSFDDARAKAQFEEYKRNYFE
GSLGEDDNLDFSQNIVVDKEYLLEKISSLARSSERGYIHYIVQLQGDKISYEAACNLFAK
TPYDSVLFQKNIEDSEIAYYYNPGDGEIQEIDKYKIPSIISDRPKIKLTFIGHGKDEFNT
DIFAGFDVDSLSTEIEAAIDLAKEDISPKSIEINLLGCNMFSYSINVEETYPGKLLLKVK
DKISELMPSISQDSIIVSANQYEVRINSEGRRELLDHSGEWINKEESIIKDISSKEYISF
NPKENKITVKSKNLPELSTLLQEIRNNSNSSDIELEEKVMLTECEINVISNIDTQIVEER
IEEAKNLTSDSINYIKDEFKLIESISDALCDLKQQNELEDSHFISFEDISETDEGFSIRF
INKETGESIFVETEKTIFSEYANHITEEISKIKGTIFDTVNGKLVKKVNLDTTHEVNTLN
AAFFIQSLIEYNSSKESLSNLSVAMKVQVYAQLFSTGLNTITDAAKVVELVSTALDETID
LLPTLSEGLPIIATIIDGVSLGAAIKELSETSDPLLRQEIEAKIGIMAVNLTTATTAIIT
SSLGIASGFSILLVPLAGISAGIPSLVNNELVLRDKATKVVDYFKHVSLVETEGVFTLLD
DKIMMPQDDLVISEIDFNNNSIVLGKCEIWRMEGGSGHTVTDDIDHFFSAPSITYREPHL
SIYDVLEVQKEELDLSKDLMVLPNAPNRVFAWETGWTPGLRSLENDGTKLLDRIRDNYEG
EFYWRYFAFIADALITTLKPRYEDTNIRINLDSNTRSFIVPIITTEYIREKLSYSFYGSG
GTYALSLSQYNMGINIELSESDVWIIDVDNVVRDVTIESDKIKKGDLIEGILSTLSIEEN
KIILNSHEINFSGEVNGSNGFVSLTFSILEGINAIIEVDLLSKSYKLLISGELKILMLNS
NHIQQKIDYIGFNSELQKNIPYSFVDSEGKENGFINGSTKEGLFVSELPDVVLISKVYMD
DSKPSFGYYSNNLKDVKVITKDNVNILTGYYLKDDIKISLSLTLQDEKTIKLNSVHLDES
GVAEILKFMNRKGNTNTSDSLMSFLESMNIKSIFVNFLQSNIKFILDANFIISGTTSIGQ
FEFICDENDNIQPYFIKFNTLETNYTLYVGNRQNMIVEPNYDLDDSGDISSTVINFSQKY
LYGIDSCVNKVVISPNIYTDEINITPVYETNNTYPEVIVLDANYINEKINVNINDLSIRY
VWSNDGNDFILMSTSEENKVSQVKIRFVNVFKDKTLANKLSFNFSDKQDVPVSEIILSFT
PSYYEDGLIGYDLGLVSLYNEKFYINNFGMMVSGLIYINDSLYYFKPPVNNLITGFVTVG
DDKYYFNPINGGAASIGETIIDDKNYYFNQSGVLQTGVFSTEDGFKYFAPANTLDENLEG
EAIDFTGKLIIDENIYYFDDNYRGAVEWKELDGEMHYFSPETGKAFKGLNQIGDYKYYFN
SDGVMQKGFVSINDNKHYFDDSGVMKVGYTEIDGKHFYFAENGEMQIGVFNTEDGFKYFA
HHNEDLGNEEGEEISYSGILNFNNKIYYFDDSFTAVVGWKDLEDGSKYYFDEDTAEAYIG
LSLINDGQYYFNDDGIMQVGFVTINDKVFYFSDSGIIESGVQNIDDNYFYIDDNGIVQIG
VFDTSDGYKYFAPANTVNDNIYGQAVEYSGLVRVGEDVYYFGETYTIETGWIYDMENESD
KYYFNPETKKACKGINLIDDIKYYFDEKGIMRTGLISFENNNYYFNENGEMQFGYINIED
KMFYFGEDGVMQIGVFNTPDGFKYFAHQNTLDENFEGESINYTGWLDLDEKRYYFTDEYI
AATGSVIIDGEEYYFDPDTAQLVISE
NT seq 7101 nt   +upstreamnt  +downstreamnt
atgagtttagttaatagaaaacagttagaaaaaatggcaaatgtaagatttcgtactcaa
gaagatgaatatgttgcaatattggatgctttagaagaatatcataatatgtcagagaat
actgtagtcgaaaaatatttaaaattaaaagatataaatagtttaacagatatttatata
gatacatataaaaaatctggtagaaataaagccttaaaaaaatttaaggaatatctagtt
acagaagtattagagctaaagaataataatttaactccagttgagaaaaatttacatttt
gtttggattggaggtcaaataaatgacactgctattaattatataaatcaatggaaagat
gtaaatagtgattataatgttaatgttttttatgatagtaatgcatttttgataaacaca
ttgaaaaaaactgtagtagaatcagcaataaatgatacacttgaatcatttagagaaaac
ttaaatgaccctagatttgactataataaattcttcagaaaacgtatggaaataatttat
gataaacagaaaaatttcataaactactataaagctcaaagagaagaaaatcctgaactt
ataattgatgatattgtaaagacatatctttcaaatgagtattcaaaggagatagatgaa
cttaatacctatattgaagaatccttaaataaaattacacagaatagtggaaatgatgtt
agaaactttgaagaatttaaaaatggagagtcattcaacttatatgaacaagagttggta
gaaaggtggaatttagctgctgcttctgacatattaagaatatctgcattaaaagaaatt
ggtggtatgtatttagatgttgatatgttaccaggaatacaaccagacttatttgagtct
atagagaaacctagttcagtaacagtggatttttgggaaatgacaaagttagaagctata
atgaaatacaaagaatatataccagaatatacctcagaacattttgacatgttagacgaa
gaagttcaaagtagttttgaatctgttctagcttctaagtcagataaatcagaaatattc
tcatcacttggtgatatggaggcatcaccactagaagttaaaattgcatttaatagtaag
ggtattataaatcaagggctaatttctgtgaaagactcatattgtagcaatttaatagta
aaacaaatcgagaatagatataaaatattgaataatagtttaaatccagctattagcgag
gataatgattttaatactacaacgaatacctttattgatagtataatggctgaagctaat
gcagataatggtagatttatgatggaactaggaaagtatttaagagttggtttcttccca
gatgttaaaactactattaacttaagtggccctgaagcatatgcggcagcttatcaagat
ttattaatgtttaaagaaggcagtatgaatatccatttgatagaagctgatttaagaaac
tttgaaatctctaaaactaatatttctcaatcaactgaacaagaaatggctagcttatgg
tcatttgacgatgcaagagctaaagctcaatttgaagaatataaaaggaattattttgaa
ggttctcttggtgaagatgataatcttgatttttctcaaaatatagtagttgacaaggag
tatcttttagaaaaaatatcttcattagcaagaagttcagagagaggatatatacactat
attgttcagttacaaggagataaaattagttatgaagcagcatgtaacttatttgcaaag
actccttatgatagtgtactgtttcagaaaaatatagaagattcagaaattgcatattat
tataatcctggagatggtgaaatacaagaaatagacaagtataaaattccaagtataatt
tctgatagacctaagattaaattaacatttattggtcatggtaaagatgaatttaatact
gatatatttgcaggttttgatgtagattcattatccacagaaatagaagcagcaatagat
ttagctaaagaggatatttctcctaagtcaatagaaataaatttattaggatgtaatatg
tttagctactctatcaacgtagaggagacttatcctggaaaattattacttaaagttaaa
gataaaatatcagaattaatgccatctataagtcaagactctattatagtaagtgcaaat
caatatgaagttagaataaatagtgaaggaagaagagaattattggatcattctggtgaa
tggataaataaagaagaaagtattataaaggatatttcatcaaaagaatatatatcattt
aatcctaaagaaaataaaattacagtaaaatctaaaaatttacctgagctatctacatta
ttacaagaaattagaaataattctaattcaagtgatattgaactagaagaaaaagtaatg
ttaacagaatgtgagataaatgttatttcaaatatagatacgcaaattgttgaggaaagg
attgaagaagctaagaatttaacttctgactctattaattatataaaagatgaatttaaa
ctaatagaatctatttctgatgcactatgtgacttaaaacaacagaatgaattagaagat
tctcattttatatcttttgaggacatatcagagactgatgagggatttagtataagattt
attaataaagaaactggagaatctatatttgtagaaactgaaaaaacaatattctctgaa
tatgctaatcatataactgaagagatttctaagataaaaggtactatatttgatactgta
aatggtaagttagtaaaaaaagtaaatttagatactacacacgaagtaaatactttaaat
gctgcattttttatacaatcattaatagaatataatagttctaaagaatctcttagtaat
ttaagtgtagcaatgaaagtccaagtttacgctcaattatttagtactggtttaaatact
attacagatgcagccaaagttgttgaattagtatcaactgcattagatgaaactatagac
ttacttcctacattatctgaaggattacctataattgcaactattatagatggtgtaagt
ttaggtgcagcaatcaaagagctaagtgaaacgagtgacccattattaagacaagaaata
gaagctaagataggtataatggcagtaaatttaacaacagctacaactgcaatcattact
tcatctttggggatagctagtggatttagtatacttttagttcctttagcaggaatttca
gcaggtataccaagcttagtaaacaatgaacttgtacttcgagataaggcaacaaaggtt
gtagattattttaaacatgtttcattagttgaaactgaaggagtatttactttattagat
gataaaataatgatgccacaagatgatttagtgatatcagaaatagattttaataataat
tcaatagttttaggtaaatgtgaaatctggagaatggaaggtggttcaggtcatactgta
actgatgatatagatcacttcttttcagcaccatcaataacatatagagagccacactta
tctatatatgacgtattggaagtacaaaaagaagaacttgatttgtcaaaagatttaatg
gtattacctaatgctccaaatagagtatttgcttgggaaacaggatggacaccaggttta
agaagcttagaaaatgatggcacaaaactgttagaccgtataagagataactatgaaggt
gagttttattggagatattttgcttttatagctgatgctttaataacaacattaaaacca
agatatgaagatactaatataagaataaatttagatagtaatactagaagttttatagtt
ccaataataactacagaatatataagagaaaaattatcatattctttctatggttcagga
ggaacttatgcattgtctctttctcaatataatatgggtataaatatagaattaagtgaa
agtgatgtttggattatagatgttgataatgttgtgagagatgtaactatagaatctgat
aaaattaaaaaaggtgatttaatagaaggtattttatctacactaagtattgaagagaat
aaaattatcttaaatagccatgagattaatttttctggtgaggtaaatggaagtaatgga
tttgtttctttaacattttcaattttagaaggaataaatgcaattatagaagttgattta
ttatctaaatcatataaattacttatttctggcgaattaaaaatattgatgttaaattca
aatcatattcaacagaaaatagattatataggattcaatagcgaattacagaaaaatata
ccatatagctttgtagatagtgaaggaaaagagaatggttttattaatggttcaacaaaa
gaaggtttatttgtatctgaattacctgatgtagttcttataagtaaggtttatatggat
gatagtaagccttcatttggatattatagtaataatttgaaagatgtcaaagttataact
aaagataatgttaatatattaacaggttattatcttaaggatgatataaaaatctctctt
tctttgactctacaagatgaaaaaactataaagttaaatagtgtgcatttagatgaaagt
ggagtagctgagattttgaagttcatgaatagaaaaggtaatacaaatacttcagattct
ttaatgagctttttagaaagtatgaatataaaaagtattttcgttaatttcttacaatct
aatattaagtttatattagatgctaattttataataagtggtactacttctattggccaa
tttgagtttatttgtgatgaaaatgataatatacaaccatatttcattaagtttaataca
ctagaaactaattatactttatatgtaggaaatagacaaaatatgatagtggaaccaaat
tatgatttagatgattctggagatatatcttcaactgttatcaatttctctcaaaagtat
ctttatggaatagacagttgtgttaataaagttgtaatttcaccaaatatttatacagat
gaaataaatataacgcctgtatatgaaacaaataatacttatccagaagttattgtatta
gatgcaaattatataaatgaaaaaataaatgttaatatcaatgatctatctatacgatat
gtatggagtaatgatggtaatgattttattcttatgtcaactagtgaagaaaataaggtg
tcacaagttaaaataagattcgttaatgtttttaaagataagactttggcaaataagcta
tcttttaactttagtgataaacaagatgtacctgtaagtgaaataatcttatcatttaca
ccttcatattatgaggatggattgattggctatgatttgggtctagtttctttatataat
gagaaattttatattaataactttggaatgatggtatctggattaatatatattaatgat
tcattatattattttaaaccaccagtaaataatttgataactggatttgtgactgtaggc
gatgataaatactactttaatccaattaatggtggagctgcttcaattggagagacaata
attgatgacaaaaattattatttcaaccaaagtggagtgttacaaacaggtgtatttagt
acagaagatggatttaaatattttgccccagctaatacacttgatgaaaacctagaagga
gaagcaattgattttactggaaaattaattattgacgaaaatatttattattttgatgat
aattatagaggagctgtagaatggaaagaattagatggtgaaatgcactattttagccca
gaaacaggtaaagcttttaaaggtctaaatcaaataggtgattataaatactatttcaat
tctgatggagttatgcaaaaaggatttgttagtataaatgataataaacactattttgat
gattctggtgttatgaaagtaggttacactgaaatagatggcaagcatttctactttgct
gaaaacggagaaatgcaaataggagtatttaatacagaagatggatttaaatattttgct
catcataatgaagatttaggaaatgaagaaggtgaagaaatctcatattctggtatatta
aatttcaataataaaatttactattttgatgattcatttacagctgtagttggatggaaa
gatttagaggatggttcaaagtattattttgatgaagatacagcagaagcatatataggt
ttgtcattaataaatgatggtcaatattattttaatgatgatggaattatgcaagttgga
tttgtcactataaatgataaagtcttctacttctctgactctggaattatagaatctgga
gtacaaaacatagatgacaattatttctatatagatgataatggtatagttcaaattggt
gtatttgatacttcagatggatataaatattttgcacctgctaatactgtaaatgataat
atttacggacaagcagttgaatatagtggtttagttagagttggtgaagatgtatattat
tttggagaaacatatacaattgagactggatggatatatgatatggaaaatgaaagtgat
aaatattatttcaatccagaaactaaaaaagcatgcaaaggtattaatttaattgatgat
ataaaatattattttgatgagaagggcataatgagaacgggtcttatatcatttgaaaat
aataattattactttaatgagaatggtgaaatgcaatttggttatataaatatagaagat
aagatgttctattttggtgaagatggtgtcatgcagattggagtatttaatacaccagat
ggatttaaatactttgcacatcaaaatactttggatgagaattttgagggagaatcaata
aactatactggttggttagatttagatgaaaagagatattattttacagatgaatatatt
gcagcaactggttcagttattattgatggtgaggagtattattttgatcctgatacagct
caattagtgattagtgaatag

DBGET integrated database retrieval system