KEGG   Phyllostomus discolor (pale spear-nosed bat): 114490024
Entry
114490024         CDS       T07739                                 
Name
(RefSeq) LOW QUALITY PROTEIN: melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
pdic  Phyllostomus discolor (pale spear-nosed bat)
Pathway
pdic04927  Cortisol synthesis and secretion
pdic04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:pdic00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    114490024
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    114490024
SSDB
Motif
Pfam: MRAP FixQ DUF485
Other DBs
NCBI-GeneID: 114490024
NCBI-ProteinID: XP_028359714
EnsemblRapid: ENSPDIG00005019888
UniProt: A0A6J2KYL6
LinkDB
Position
2:1467440..1476321
AA seq 199 aa
MVNGTNASGPDYGYEYYLDYLDFVPVDERKLRVHKHAITIAFWVSLVAFVLLLLLVLLYV
SWSGSPPARNHAQHQPACPWSLCLDLPLRVLRHLLLHRVPQGTPRAPPCSTKEPQQLRQE
GPAPSTSTAPQAPSALLWEPALGGDPLASADVSHKPGWPPLEMGRTPANHNHRRAACDTH
QPGHVCPRKATAGHGKGGM
NT seq 600 nt   +upstreamnt  +downstreamnt
atggtcaacggcaccaacgcctcgggcccggactacggctacgagtactacctggactac
ctggacttcgtccccgtggacgagaggaagctgcgggtccacaaacacgccatcaccatc
gccttctgggtgagcctggtggccttcgtgctgctcctgctgctggtcctgctctacgtg
tcctggtcgggctccccgccggcgcggaaccacgcccagcaccagcccgcctgcccctgg
agtctctgcctggacctccccctccgcgtgctgaggcacctgctgctccacagggtcccc
caggggaccccgagggccccgccctgctccaccaaggagccgcagcagttgagacaggag
ggtcccgccccctcgacctccaccgccccccaggccccctctgctctcctgtgggaaccg
gccctcggtggggaccccctggcatcagctgacgtcagccacaagcccggctggccaccc
ctggagatgggacggacgccagcaaaccacaaccaccgccgggcggcctgtgacacacac
cagcccgggcacgtgtgcccccggaaagccaccgcaggtcacgggaagggcggcatgtga

DBGET integrated database retrieval system