KEGG   Pseudomonas sp. ATCC 13867: H681_01365
Entry
H681_01365        CDS       T02524                                 
Name
(GenBank) polyphosphate kinase
  KO
K00937  polyphosphate kinase [EC:2.7.4.1]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00190  Oxidative phosphorylation
pdr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    H681_01365
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    H681_01365
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdr03019]
    H681_01365
Enzymes [BR:pdr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.1  ATP-polyphosphate phosphotransferase
     H681_01365
Messenger RNA biogenesis [BR:pdr03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     H681_01365
SSDB
Motif
Pfam: PP_kinase_C_1 PP_kinase_C PP_kinase PP_kinase_N PLDc_2
Other DBs
NCBI-ProteinID: AGI22155
UniProt: M4X9W4
LinkDB
Position
303576..305768
AA seq 730 aa
MNTEGLSETELLEADSTDVIVAETTEATPPPPEVTVPAVNVDDSALYIHRELSQLQFNIR
VLQQALDESYPLLERLKFLLIFSSNLDEFFEIRVAGLKKQITFAREQAGADGLLPHQALA
RISEQVHEQVARQYSILNDILLPELAKHDIRFIRRRYWTPKIKAWVRRFFRDEIAPIVTP
IGLDPTHPFPLLVNKSLNFMVELEGLDAFGRDSGLAIIPAPRSLPRIIRLPEEVAGPGDN
YVFLSSMIHAHADDLFHGMKVKGCYQFRLTRNADLSVDAEDVEDLARALRGELFSRRYGD
AVRLEVVDTCPTHLSNYLLKQFGLSETELYRVSGPVNLTRLFSVTGLASHPELQHPPFTP
AIPKLLQKKENLFNVLGKLDVLLMHPFESFTPVIDLLRQAAKDPSVLAIKQTLYRSGANS
EIVDALVEAARNGKEVTVVIELRARFDEESNLQLASRLQQAGAVVIYGVVGFKTHAKMML
ILRREDGELRRYAHLGTGNYHAGNARLYTDYSLLTADVALCEDLHKLFNQLIGMGKTLRM
KKLLHAPFTLKKNLLEMINREAAQAAEGKPAQIMAKVNSLTDAKVIRALYKASQAGVKID
LVVRGMCCLRPGVPGVSHNIQVRSIIGRFLEHSRIYYFLNGGEEKLYLSSADWMERNLDM
RVETCFPVEGKKLVLRVKKELESYLTDNTLAWVLQSDGSYVRQSPSGNQNARNSQAMLLE
RLCTPVISSR
NT seq 2193 nt   +upstreamnt  +downstreamnt
atgaataccgaaggccttagcgaaaccgaactcctcgaagccgactccaccgacgtcatc
gtggccgagaccaccgaagcgacccctccgccgccggaggtgaccgtcccagcggtcaac
gtggacgacagcgccctctacattcatcgcgagctctcgcagctgcagttcaacatccgc
gtgctgcaacaggcgctggatgagtcctacccgttgctggaacgcctgaagttcctgctg
atcttctccagcaacctcgacgagttcttcgagatccgcgtcgccggcctgaagaagcag
atcaccttcgcccgcgaacaggccggcgccgacggcctgctgccgcaccaggcgctggcg
cgcatcagcgagcaggtgcacgagcaggtcgcccgccagtacagcatcctcaacgacatc
ctgttgccggagctggccaagcacgatattcgcttcatccgccgccgctactggacgccg
aagatcaaggcctgggtccgccgcttcttccgcgacgagatcgcgcccatcgtcaccccg
attggcctcgatccgacccacccgttcccgctgctggtgaacaagagcctgaacttcatg
gtcgagctcgagggcctggacgccttcggccgcgactcgggcctggcgatcatcccggcg
ccgcgttcgttgccgcggatcatccgtctgccggaagaggtcgccggccccggcgacaac
tacgtgttcctctcgtcgatgatccacgcccatgccgacgacctgttccacggcatgaag
gtgaaaggctgctaccagttccgcctgacccgtaacgccgacctttcggtggacgccgag
gacgtcgaggacctggcccgcgcgctgcgtggcgagctgttctcgcgccgctacggcgac
gccgtgcgcctggaggtagtggacacctgcccgacgcacctgtccaactacctgctcaag
cagttcggcctgtccgaaaccgagctgtaccgggtcagcggcccggtcaacctgacgcgc
ctgttcagtgtcaccggcctcgccagccatccggaactgcagcacccgccgttcactccg
gcgattcccaagctgctgcagaagaaggaaaacctgttcaacgtcctgggcaagctcgac
gtgctgctgatgcacccgttcgagtccttcaccccggtgatcgacctgctgcgccaggcc
gccaaggaccccagcgtgctggcgatcaagcagacgctgtaccgttccggcgccaactcc
gagatcgtcgacgcgctggtggaagccgcgcgcaacggcaaggaagtcaccgtggtgatc
gaactgcgggcgcgcttcgacgaggaatccaacctgcagctggccagccgcttgcagcag
gccggcgcggtagtgatctacggtgtggtcggcttcaagacccacgccaagatgatgctg
atcctgcgtcgcgaggacggcgagctgcgccgctacgcgcacctgggcaccggcaactac
cacgccggcaacgcccgcctgtacaccgactacagcctgctgaccgccgacgtggcgctc
tgcgaggacctgcacaagctgttcaaccagctgatcggcatgggcaagaccctgcgcatg
aagaagctcctgcacgcgcccttcaccctgaagaagaacctgctggagatgatcaaccgc
gaggctgcccaggccgccgagggcaagccggcgcagatcatggccaaggtcaactcgctg
accgacgccaaggtcatccgcgcgctgtacaaggccagccaggccggcgtgaagatcgac
ctggtggtgcgcggcatgtgctgcctgcgtccgggtgtgccgggcgtgtcgcacaacatc
caggtgcgctcgatcatcggccgcttcctggagcacagccggatctactacttcctcaac
ggcggcgaggagaagctctatctctccagcgccgactggatggagcgcaacctcgacatg
cgtgtggagacctgcttcccggtggaaggcaagaagctggtgctgcgggtgaagaaggag
ctggagtcctacctgaccgacaacaccctggcctgggtgctgcagtccgacggcagctac
gtgcgccagagccccagcggcaaccagaacgcccgcaactcccaggcgatgctgctggag
cggctgtgtacgccggtgatcagttcgcgctga

KEGG   Pseudomonas sp. ATCC 13867: H681_05935
Entry
H681_05935        CDS       T02524                                 
Name
(GenBank) hypothetical protein
  KO
K22468  polyphosphate kinase [EC:2.7.4.34]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00190  Oxidative phosphorylation
pdr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    H681_05935
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    H681_05935
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdr03019]
    H681_05935
Enzymes [BR:pdr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.34  GDP-polyphosphate phosphotransferase
     H681_05935
Messenger RNA biogenesis [BR:pdr03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     H681_05935
SSDB
Motif
Pfam: PPK2 Microtub_bd
Other DBs
NCBI-ProteinID: AGI23067
UniProt: M4WWF7
LinkDB
Position
complement(1294175..1294996)
AA seq 273 aa
MMGKKSKSSASAAEKPKKLGNKEYEEQLKKLTVELVKLQQWVVHKGLKVCIIFEGRDGAG
KGGTIKAITERVSPRVFRTVALPAPTEREKSQLYVQRYISHLPAAGEVVIFDRSWYNRAG
VERVMGFCTEEQADKFLAVTPLFERMMTESGIILLKYWLEVTPEEQARRLEDRINDGRKI
WKLSPMDVKSFTRWDEYTRARDLMFASTDTPWAPWFVAHSEDKKRVRLNIIDHLLQHIPY
KDVPREKVELPKRGKIGRYKSPDYPYRYVEDVY
NT seq 822 nt   +upstreamnt  +downstreamnt
atgatgggcaagaagagcaagtcgagcgcttctgcggcggagaagccgaagaaacttggc
aacaaggaatacgaagaacagctgaagaaactcaccgtcgaactggtcaagctccagcag
tgggtcgtgcacaagggcctgaaggtctgcatcatcttcgaagggcgcgacggcgccggc
aagggcggcaccatcaaggccatcaccgaacgcgtcagcccgcgggtgttccgcaccgtg
gcgctgccggcgcccaccgagcgcgagaaatcgcagctctacgtgcagcgctatatctcc
cacctgccggcggccggcgaggtggtgatcttcgaccgcagctggtacaaccgcgccggg
gtcgagcgggtgatgggcttctgcaccgaggagcaggccgacaagttccttgccgtcacg
ccgctgttcgagcggatgatgaccgagtcggggatcatcctgctcaagtactggctggag
gtgacgcccgaggagcaggcgcgccgtctcgaggatcgcatcaacgacggccgcaagatc
tggaagctgtcgccgatggacgtgaaatccttcacccgctgggacgagtacacccgcgcc
cgcgacctgatgttcgccagcaccgacacgccctgggcgccctggttcgtcgcgcactcc
gaggacaagaagcgcgtacggctgaacatcatcgaccacctgctccagcacatcccgtac
aaggacgtgccgcgcgagaaggtcgaactgcccaagcgcggcaagatcggccgctacaag
agcccggactacccctaccgctacgtcgaggacgtctactga

KEGG   Pseudomonas sp. ATCC 13867: H681_11035
Entry
H681_11035        CDS       T02524                                 
Name
(GenBank) hypothetical protein
  KO
K22468  polyphosphate kinase [EC:2.7.4.34]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00190  Oxidative phosphorylation
pdr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    H681_11035
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    H681_11035
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdr03019]
    H681_11035
Enzymes [BR:pdr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.34  GDP-polyphosphate phosphotransferase
     H681_11035
Messenger RNA biogenesis [BR:pdr03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     H681_11035
SSDB
Motif
Pfam: PPK2
Other DBs
NCBI-ProteinID: AGI24077
UniProt: M4WZB4
LinkDB
Position
2414447..2415364
AA seq 305 aa
MLLDDKNFPQRIQSDLLDDQDEELELELFDELYDLDGLRHGNLQSHEERLARQRYFHTLF
RLQGELVKLQSWVVKTGHKVVILFEGRDAAGKGGVIKRITQRLNPRVCRVAALSAPNDRE
RTQWYFQRYVSHLPAAGEIVLFDRSWYNRAGVERVMGFCSDDQYEEFFRSVPEFERMLVR
SGIQVIKYWFSISDEEQHFRFLSRIHDPLKQWKLSPMDLESRRRWEAYTKAKEIMLERTH
IPEAPWWVVHADDKKKARLNCIHHLLQQIPYQEVRQPNVRLPERQRHEGYQRHPTPLELQ
VPEVY
NT seq 918 nt   +upstreamnt  +downstreamnt
atgctgcttgatgacaagaatttcccccagcgtatccagagcgacctgctcgacgaccag
gacgaagagctggaactcgaactgttcgacgaactgtacgatctcgacggcctgcgccac
ggcaacctgcaatcccacgaagagcgcctggcgcgccagcgctacttccacaccctgttc
cgcctgcagggcgaactggtaaagctgcagagctgggtagtgaagaccggccacaaggtg
gtgatcctcttcgaaggtcgcgacgcggcgggcaagggcggggtgatcaagcgcatcacc
cagcgcctcaacccgcgcgtctgccgcgtcgccgcgctgtcggcgccgaacgaccgcgag
cgcacccagtggtacttccagcgctacgtctcgcacctgccggcggcgggcgagatcgtc
ctgttcgatcgcagctggtacaaccgcgctggcgtcgagcgggtgatgggcttctgttcc
gatgaccagtacgaagagttcttccgcagcgtgcccgagttcgaacgcatgctggtgcgt
tccgggatccaggtcatcaagtactggttctccatctccgacgaggagcagcacttccgt
ttcctcagccgcatccacgatccgctcaagcaatggaaactcagcccgatggacctggag
tcgagacggcgctgggaggcctacaccaaggccaaggaaatcatgctcgagcgcacccac
atccccgaggcgccctggtgggtggtgcacgccgacgacaagaaaaaggcccggctcaac
tgcatccaccacctgctccagcagattccctaccaggaagtacggcagcccaacgtccgc
ctccccgaacgccagcgccacgagggctaccagcggcaccccacgccgctggagctgcag
gtaccggaagtctactga

KEGG   Pseudomonas sp. ATCC 13867: H681_23925
Entry
H681_23925        CDS       T02524                                 
Name
(GenBank) polyphosphate kinase
  KO
K22468  polyphosphate kinase [EC:2.7.4.34]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00190  Oxidative phosphorylation
pdr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    H681_23925
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    H681_23925
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdr03019]
    H681_23925
Enzymes [BR:pdr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.34  GDP-polyphosphate phosphotransferase
     H681_23925
Messenger RNA biogenesis [BR:pdr03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     H681_23925
SSDB
Motif
Pfam: PPK2 MeaB
Other DBs
NCBI-ProteinID: AGI26652
UniProt: M4X6F8
LinkDB
Position
complement(5364697..5365665)
AA seq 322 aa
MPQPDSNKPAPASAPTVGGEEIRAQSHGPVALTVALAPRGSNEDSTSAELPAGYPYRRRL
QRKEYEAQKAQLQVELLKVQSWVKETGQRIVVLFEGRDAAGKGGTIKRFMEHLNPRGARV
VALEKPSDAERGQWYFQRYIQHLPTAGEIVFFDRSWYNRAGVERVMGFCSPRQYLEFMQQ
TPELERMLVRNGIHLLKYWFSVSREEQLRRFVSRRDDPLKHWKLSPIDIQSLDRWDEYTQ
AKEAMFFHTDTADAPWVVIKSDDKKRARLNCLRHFLHVLDYPGKDLRIARAPDDRLVGRA
AELDRDELERPIPAPVAEPIPA
NT seq 969 nt   +upstreamnt  +downstreamnt
atgccgcagcccgactccaacaagcccgctcccgccagcgcacccaccgtgggtggcgag
gaaatccgcgcgcaaagccacggcccggtggcgctgaccgtcgccctggccccgcgcggc
agcaacgaggactccacctccgccgagttgcccgccggctatccctaccgccgccgcctg
caacgcaaggagtacgaggcacagaaggcgcaactgcaggtcgagctgctgaaggtgcag
agctgggtgaaggaaaccggccagcgcatcgtcgtgctcttcgagggccgcgacgccgcc
ggcaagggtgggaccatcaagcgcttcatggagcacctcaacccgcgcggcgcccgcgtt
gtggcgctggagaagcccagcgacgccgagcgcgggcagtggtatttccagcgctacatc
cagcacctgcccaccgccggcgagatcgtcttcttcgaccgctcctggtacaaccgcgcc
ggggtcgagcgggtcatgggcttctgctcgccgcgccagtacctggagttcatgcagcag
accccggagctggagcggatgctggtgcgcaacggcatccacctgctcaagtactggttc
tcggtgagccgggaagagcagctgcgccgcttcgtctcgcgccgcgacgacccgctcaag
cactggaagctgtcgcccatcgacatccagtcgctggaccgctgggacgagtacacccag
gccaaggaggcgatgttcttccacaccgacaccgccgatgcgccctgggtggtgatcaag
tccgacgacaagaagcgcgcgcggctgaactgcctgcgccacttcctgcacgtgctggac
taccccggcaaggacctgaggatcgcccgcgccccggacgaccggctggtgggccgggcc
gccgaactggaccgcgacgagctggagcgcccgataccggctccggtggcggagccgata
ccggcctga

DBGET integrated database retrieval system