KEGG   Pseudomonas sp. ATCC 13867: H681_01380
Entry
H681_01380        CDS       T02524                                 
Symbol
rho
Name
(GenBank) transcription termination factor Rho
  KO
K03628  transcription termination factor Rho
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    H681_01380 (rho)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pdr03021]
    H681_01380 (rho)
   03019 Messenger RNA biogenesis [BR:pdr03019]
    H681_01380 (rho)
Transcription machinery [BR:pdr03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    Transcription termination factor
     H681_01380 (rho)
Messenger RNA biogenesis [BR:pdr03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     H681_01380 (rho)
SSDB
Motif
Pfam: Rho_RNA_bind ATP-synt_ab Rho_N OB_RNB NACHT AAA_25 AAA AAA_22 Mor
Other DBs
NCBI-ProteinID: AGI22158
UniProt: M4WQ51
LinkDB
Position
308168..309430
AA seq 420 aa
MNLTELKQKPIAELLEMSDAMGLENMARSRKQDIIFALLKKHAKSGEEISGDGVLEILQD
GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIIGKIRPPKEGERYFALLKVDSIN
FDRPENAKNKILFENLTPLFPTKRLTMEAGNGSTEDLTGRVIDLCSPIGKGQRGLIVAPP
KAGKTIMLQNIASNITRNNPECHLIVLLIDERPEEVTEMQRTVRGEVVASTFDEPPTRHV
QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVIPSSGKVLTGGVDAHALEKPKRF
FGAARNIEEGGSLTILATALIETGSKMDEVIYEEFKGTGNSELILDRRISEKRVFPAINI
NRSGTRREELLTGEEELQRMWILRKILHPMDEIAAVEFLLDKLRQTKTNDEFFDSMKRSK
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgaatctgaccgaactcaagcaaaagccgattgccgaattgctggaaatgtccgatgcc
atgggcctggaaaacatggctcgttcgcgcaaacaggacatcatcttcgcgttgctgaag
aagcacgcgaaaagcggcgaggaaatctccggtgacggcgtgctggagattctccaggat
ggcttcggcttcctgcgctccgccgattcctcgtacctggccggccccgacgacatctac
gtctcgcccagccagatccggcgcttcaacctgcgcacgggcgacaccatcatcggcaag
attcgtccgccgaaggaaggcgagcgttacttcgccctgctgaaagtcgactcgatcaac
ttcgatcgtccggagaacgcgaagaacaagattctcttcgagaacctgaccccgctgttc
ccgaccaaacgcctgaccatggaagccggcaacggctccaccgaggacctcaccggccgt
gtgatcgacctctgctcgccgatcggcaagggccagcgcggcctgatcgtcgccccgccg
aaagcgggcaagaccatcatgctgcagaacatcgcctcgaacatcacccgcaacaacccc
gagtgccatctgatcgtcctgctgatcgacgagcgcccggaagaagtgaccgagatgcag
cgcaccgtgcgcggcgaagtggtcgcctccaccttcgacgaaccgccgacccgccacgtg
caggtcgccgagatggtgatcgagaaggccaagcgcctggtcgagcacaagaaggacgtg
atcatcctgctggactccatcacccgtctggcccgtgcctacaacaccgtgatccccagc
tccggcaaggtgctcaccggtggcgtcgacgcccacgccctggaaaagcccaagcgcttc
ttcggcgccgcgcgcaacatcgaggaaggcggttcgctgaccatccttgccaccgcgctg
atcgaaaccggctcgaagatggacgaagtgatctacgaggaattcaagggtaccggtaac
tcggaactcatcctcgaccgtcgcatctcggaaaaacgcgtgttcccggcgatcaacatc
aatcgctccggcacccgtcgcgaagagctgctcaccggtgaggaagagctgcagcgcatg
tggatcctgcgcaagatcctgcacccgatggacgagatcgccgccgtggaattcctcttg
gacaagctgcgccagacgaagaccaacgacgagttcttcgactccatgaagcgcagcaag
taa

DBGET integrated database retrieval system