KEGG   Pseudomonas sp. ATCC 13867: H681_01925
Entry
H681_01925        CDS       T02524                                 
Name
(GenBank) multidrug resistance operon repressor MexR
  KO
K18131  MarR family transcriptional regulator, repressor of the mexAB-oprM multidrug resistance operon
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr01501  beta-Lactam resistance
Module
pdr_M00718  Multidrug resistance, efflux pump MexAB-OprM
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    H681_01925
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pdr03000]
    H681_01925
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:pdr01504]
    H681_01925
Transcription factors [BR:pdr03000]
 Prokaryotic type
  Helix-turn-helix
   MarR family
    H681_01925
Antimicrobial resistance genes [BR:pdr01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    H681_01925
SSDB
Motif
Pfam: MarR MarR_2 HTH_27 HxlR HTH_24 HTH_38 HTH_20
Other DBs
NCBI-ProteinID: AGI22267
UniProt: M4WUB2
LinkDB
Position
complement(423909..424394)
AA seq 161 aa
MVDPINRIYIPFTVTAPMTHTVNPELPQALMKVFDHMRESLQDKLCAEGIDLAPPDIRLL
ELIGADAGQSLQCLGRKLCRDKALVTRKIREMEALGLVRRERNPDDQRSFQLFLTEAGRS
IETRTLAILARTHDDLFAPLDDAQQQMLTHLLQQCLPDRTA
NT seq 486 nt   +upstreamnt  +downstreamnt
atggttgatccgatcaatcggatttacattccgtttaccgtgaccgcgccgatgacccac
accgtgaatcccgagttgccacaagccctgatgaaggttttcgaccacatgcgcgaaagc
ctccaggacaagctgtgcgccgagggtatcgacctcgccccgccggacatccgcctgctc
gaactgatcggcgcagacgccggacagagcctgcaatgcctgggccgcaaactgtgccgc
gacaaggcgctggtcacccgcaagattcgcgagatggaagcgctcggactggtccgtcgc
gaacgcaaccctgacgaccagcgcagtttccagctgttcctcaccgaggctggccggagc
atcgagacacgcaccctggccatcctcgcacgaactcatgacgatctgttcgcgccactc
gacgacgcccagcaacagatgctcacccacctgctccaacagtgcctgccagaccgtacg
gcataa

DBGET integrated database retrieval system