KEGG   Pseudomonas sp. ATCC 13867: H681_01930
Entry
H681_01930        CDS       T02524                                 
Name
(GenBank) Resistance-Nodulation-Cell Division (RND) multidrug efflux membrane fusion protein MexA precursor
  KO
K03585  membrane fusion protein, multidrug efflux system
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr01501  beta-Lactam resistance
pdr01503  Cationic antimicrobial peptide (CAMP) resistance
Module
pdr_M00718  Multidrug resistance, efflux pump MexAB-OprM
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    H681_01930
   01503 Cationic antimicrobial peptide (CAMP) resistance
    H681_01930
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pdr03036]
    H681_01930
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pdr02000]
    H681_01930
   01504 Antimicrobial resistance genes [BR:pdr01504]
    H681_01930
Chromosome and associated proteins [BR:pdr03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    H681_01930
Transporters [BR:pdr02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   H681_01930
Antimicrobial resistance genes [BR:pdr01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    H681_01930
SSDB
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 CusB_dom_1 DivIVA OEP
Other DBs
NCBI-ProteinID: AGI22268
UniProt: M4WQE4
LinkDB
Position
424630..425769
AA seq 379 aa
MRALVPTLLVAVATLAGCDKSQAPQETPTPEVGVVTLQAQEVTLSTELPGRTTAYRIAEV
RPQVNGIILKRLFKEGSDVKEGQQLYQIDPATYQATLQSAQANLVSTQQQAERYKELVKD
EAVSKQQYADAQAAYLQAKAAVDNARINVRYTRVYSPISGRIGRSSVTEGALVQNGQADA
LATVQQLDPIYVDVTQPSTALIRLRRELAAGQLEKAGDNAAKVKLYLEDGSEYPLEGKLE
FSEVSVDQGTGSVTVRAIFPNPNKELLPGMFVHAQLQEGVKKQAILAPQQGVTRDFRGQA
TALVLGEGDKVELRTLKAERTVGAYWLVSEGLKPGDRLITEGLQFVQPGGQAKAVPAKNV
APAAGATDKPAAAQPAKQG
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgcgcgccctggttccgaccctgctcgtcgccgtggccactcttgccggctgtgacaag
agtcaggctccgcaggagacgccgacccctgaagtgggggtggtgaccctgcaggcgcag
gaggtgaccctgagcaccgagctgcccggccgcaccactgcctatcgcatcgccgaagtt
cgtccgcaggtgaacggcatcatcctcaagcgcctgttcaaggaaggcagcgacgtcaag
gaaggccagcagctgtaccagatcgacccggccacctaccaggctaccctgcagagcgcc
caggccaacctggtgtccacccagcagcaggccgagcgctacaaggaactggtgaaggac
gaggcggtgagcaagcagcagtacgccgacgcccaggccgcctatctgcaggccaaggcc
gcggtggacaatgccaggatcaacgtgcgctacaccagggtctactcgccgatctccggc
cgtatcggccgctcctcggtcaccgagggcgcgctggtgcagaacggccaggccgacgca
ctggccaccgtgcagcagctggatccgatctatgtcgacgtgacccagccctccaccgcg
ctgattcgcctgcgccgcgagctggccgccgggcagttggagaaggccggcgacaatgcc
gccaaggtcaagctgtacctggaagacggctcggaatacccgctggaaggcaagctggag
ttctccgaggtgtcggtcgaccagggcaccggctcggtcaccgtgcgcgcgatcttcccc
aacccgaacaaggaactgctgccgggcatgttcgtccacgcgcagcttcaggaaggggtg
aagaagcaggcgatcctcgccccgcagcagggcgtgacccgcgatttccgtggccaggct
accgcgcttgtgctgggcgaaggcgacaaggtcgagctgcgtaccctcaaggccgaacgc
accgtcggcgcctactggctggtcagcgaaggcctcaagcccggcgatcgcctgatcacc
gaaggcctgcagttcgtccagccgggggggcaggccaaggccgtacccgcgaagaacgtg
gcgcccgccgccggggccaccgacaaacccgccgccgcgcaaccggccaagcagggttaa

KEGG   Pseudomonas sp. ATCC 13867: H681_04255
Entry
H681_04255        CDS       T02524                                 
Name
(GenBank) RND family efflux transporter MFP subunit
  KO
K03585  membrane fusion protein, multidrug efflux system
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr01501  beta-Lactam resistance
pdr01503  Cationic antimicrobial peptide (CAMP) resistance
Module
pdr_M00718  Multidrug resistance, efflux pump MexAB-OprM
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    H681_04255
   01503 Cationic antimicrobial peptide (CAMP) resistance
    H681_04255
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pdr03036]
    H681_04255
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pdr02000]
    H681_04255
   01504 Antimicrobial resistance genes [BR:pdr01504]
    H681_04255
Chromosome and associated proteins [BR:pdr03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    H681_04255
Transporters [BR:pdr02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   H681_04255
Antimicrobial resistance genes [BR:pdr01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    H681_04255
SSDB
Motif
Pfam: HlyD_D23 Biotin_lipoyl_2 HlyD_3 OEP CusB_dom_1 Biotin_lipoyl DUF4795
Other DBs
NCBI-ProteinID: AGI22733
UniProt: M4WRL9
LinkDB
Position
919754..920785
AA seq 343 aa
MTLEYAARTAGYREVEVRAQVSGILQRRTYEEGRPVKEGQVLFRIDPRPYQAALGQAKGS
LAQAQARYRQTERDLKRIRELQKKGFASESELDRYISDFEQAKADVEAARANVDAKQIDL
NYTTVTAPISGMASKETRSEGSLVAANDPNSSLLTKLTQLDPVYVNFAYPDTEAARLRDG
VQSGRLSLPADGKLSAELRFGDGSKYPVDGVVDFTDSFVNTGTGTVNARAVVPNPKNQLI
PGQFVRVLIKGIAHKNAVTLPERALAQGPRGTFVYVVDKDGFARVRQVTTSQTVNGRWII
DAGVDDGDKVIVDGLLKVRPDQPVRAVEGGAQEPAANPAQTPS
NT seq 1032 nt   +upstreamnt  +downstreamnt
gtgaccctggagtatgctgcccggaccgctggttaccgtgaggtggaagtgcgcgcccag
gtcagcggcatcctgcagcgccgtacctatgaagaaggtcgcccggtgaaggaagggcag
gtgctgttccgtatcgatccgcgcccctaccaggcggcactggggcaggccaagggctcg
ctggcacaggcccaggcgcgctatcggcagaccgaacgcgatctcaagcgtatccgcgaa
ctgcagaagaagggcttcgccagcgaaagcgaactggaccgctacatttccgacttcgag
caggccaaggcggatgtcgaggctgctcgcgccaacgtcgatgccaagcagatcgacctg
aactacaccacggtgaccgcgcccatttccggcatggcgagcaaggaaacccgttccgag
ggcagcctggtggcggcgaacgacccgaactccagcctgctgaccaagctcacgcaactg
gatccggtgtacgtcaacttcgcctatcccgataccgaggccgcgcgcctgcgcgatggc
gtgcagagcggcaggctgagcctgcccgcggacggcaagctgagcgccgagttgcgcttc
ggcgatggttccaagtatcccgtcgatggcgtggtcgacttcaccgacagcttcgtcaat
accggcaccggcacggtgaatgcccgcgccgtggtacccaacccgaagaaccagttgatt
ccggggcagttcgtccgtgtgctgatcaagggcatcgcccacaagaacgcggtgacgctg
cccgagcgcgcattggcccaggggccgcgcggtaccttcgtctatgttgtggacaaggac
ggtttcgcccgcgtgcgccaggtgacgacctcgcagaccgtgaacggccgctggatcatc
gacgctggcgtggatgacggcgacaaggtcatcgtcgacggcctgctcaaggttcgtccc
gaccagccggtccgagccgtcgaaggtggcgcgcaggaaccggcggccaatcccgcccag
accccgtcataa

KEGG   Pseudomonas sp. ATCC 13867: H681_20555
Entry
H681_20555        CDS       T02524                                 
Name
(GenBank) putative Resistance-Nodulation-Cell Division (RND) efflux membrane fusion protein
  KO
K03585  membrane fusion protein, multidrug efflux system
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr01501  beta-Lactam resistance
pdr01503  Cationic antimicrobial peptide (CAMP) resistance
Module
pdr_M00718  Multidrug resistance, efflux pump MexAB-OprM
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    H681_20555
   01503 Cationic antimicrobial peptide (CAMP) resistance
    H681_20555
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pdr03036]
    H681_20555
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pdr02000]
    H681_20555
   01504 Antimicrobial resistance genes [BR:pdr01504]
    H681_20555
Chromosome and associated proteins [BR:pdr03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    H681_20555
Transporters [BR:pdr02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   H681_20555
Antimicrobial resistance genes [BR:pdr01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    H681_20555
SSDB
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 CusB_dom_1 Biotin_lipoyl CSD2
Other DBs
NCBI-ProteinID: AGI25978
UniProt: M4X0Q6
LinkDB
Position
4599060..4600172
AA seq 370 aa
MLRRMLIMLGVVAVIIAVLAGSKYLSIQKQIALFSAPRPPVSVTATDAVQRDWQSRLPAI
GTLRAIQGVTVTAEVSGIVRSIQFISGDKVKQDQPILQMDDDVEQATLRSAEADLGLAQV
EYNRGRNLIDRQAISRSDYDRLAAQLNRSTATVAQLRAALAKKRILAPFDGTAGIRRVDV
GDYVSPGTEIVTLQDLSTLLVDFFLPEQDFPLLKTGQAVSVRVAAYPGQRFEARIEAISP
RVDNETRNLLVRASMGNPDGKLLPGMFANLEVQLPDSAPRIVVPETAVAFTLYGNSVYVV
GPQKDKDGMVQTNDKGEPALAVERRFVKTGERREGSVVIVEGLKAGERVVTSGQLKLDSG
TPVAIVPDAQ
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgttgcgccgcatgctgatcatgctgggcgtggttgccgtcatcattgcggtgctcgcc
ggctcgaagtacctctccatccagaaacagatcgccctgttctcggctccgcggccaccg
gtcagcgtcaccgcgaccgacgccgtgcagcgtgactggcaaagccgcctgccggccatc
ggcaccctgcgcgccatccagggtgtgacggtcaccgccgaagtctcgggcatcgtgcgc
agcatccagttcatctccggcgacaaggtgaagcaggaccagcccatcctgcagatggat
gacgacgtcgagcaggccaccctgcgcagcgccgaggcggacctcggcctggcccaggtg
gagtacaaccgtggccgcaacctgatcgaccgccaggccatttccaggagcgactacgac
cgtctcgcggcccagctgaaccgctccaccgccaccgtggcacagctgcgcgcggcgctg
gcgaagaagcgcatcctcgcgcccttcgacggcaccgccggcatccgccgggtggacgtg
ggcgactacgtctcgccgggcaccgagatcgtcaccctgcaggacctttccaccttgctg
gtcgacttcttcctgccggaacaggacttccccctgctcaagaccggccaggccgtcagc
gtgagggtcgcggcctaccccggacagcgtttcgaggcgcgcatcgaggcgatcagccca
cgggtggacaacgagacccgcaacctgctggtccgcgccagcatgggcaaccccgacggc
aagctgctgccgggcatgttcgccaacctggaagtgcagctgcccgacagcgcgccgcgc
atcgtggtcccggaaaccgccgtggccttcaccctctacggcaactcggtgtacgtggtc
ggcccgcagaaggacaaggacggcatggtgcagaccaacgacaagggcgaaccggccctg
gccgtggagcgccgcttcgtcaagaccggcgagcgccgcgaaggcagcgtggtgatcgtc
gagggcctgaaggccggcgagcgggtcgtcacctccggccagctcaagctcgacagcggc
acgccggtggcgatcgttccggacgcacagtaa

DBGET integrated database retrieval system