KEGG   Pseudomonas sp. ATCC 13867: H681_01935
Entry
H681_01935        CDS       T02524                                 
Name
(GenBank) RND multidrug efflux transporter MexB
  KO
K18138  multidrug efflux pump
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr01501  beta-Lactam resistance
pdr01503  Cationic antimicrobial peptide (CAMP) resistance
Module
pdr_M00718  Multidrug resistance, efflux pump MexAB-OprM
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    H681_01935
   01503 Cationic antimicrobial peptide (CAMP) resistance
    H681_01935
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pdr02000]
    H681_01935
   01504 Antimicrobial resistance genes [BR:pdr01504]
    H681_01935
Transporters [BR:pdr02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   H681_01935
Antimicrobial resistance genes [BR:pdr01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    H681_01935
SSDB
Motif
Pfam: ACR_tran MMPL SecD_SecF
Other DBs
NCBI-ProteinID: AGI22269
UniProt: M4WRC5
LinkDB
Position
425785..428925
AA seq 1046 aa
MSKFFIDRPIFAWVIALVIMLAGGLSILKLPVNQYPAIAPPAIAIQVSYPGASAETVQDT
VVQVIEQQMNGLDHLRYISSESNSDGSMTITVTFDQGTSPDIAQVQVQNKLQLATPLLPQ
EVQQQGIRVTKAVKNFLMVVGVVSTDGGMTREDLSNYIVSNIQDPLSRTSGVGDFQVFGS
QYAMRIWLDPAKLNSFQMTPGDVRAAIEAQNVQISSGQLGGLPAVKGQQLNATIIGKTRL
QSAEQFKEILLKVNADGSQVRLKDVADVALGGQDYSINAQFNGKPASGIAIKLATGANAL
DTAKAIRSTLGTLEPFFPQGMKIVYPYDTTPVVSASIHEVVKTLGEAILLVFLVMYLFLQ
NFRATLIPTIAVPVVLLGTFGVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVM
AEEGLSPREAARKSMGQIQGALVGIALVLSAVFLPMAFFGGSTGVIYRQFSITIVSAMAL
SVLVALVLTPALCATMLKPIEKGDHGEHKRGFFGWFNRMFLATTHGYERGVVSILKHRFP
YLLMYVVILGGMVYLFTRIPTAFLPDEDQGVLFAQVQTPAGSSAERTQVVVDAMRSYLLE
QESSAVASVFTVTGFNFAGRGQSSGMAFIMLKPWEERPGKENSVFELAHRAQEHFFTFKD
AMVFAFAPPAVLELGNAVGFDIFLQDQAGVGHEVLMGARNQFLGLAERNPALQRVRPNGL
NDEPQYKLLIDDEKASALGLSLADINSTLSIAWGSNYVNDFIDRGRVKKVYLQGRPNARM
SPEDLDKWYVRNDKGEMVPFSAFATGEWSYGSPKLSRYNGVPAMEILGEPAMGRSTGEAM
AAVEEIVKQLPKGVGYAWTGLSYEERLSGSQAPALYALSLIVVFLCLAALYESWSIPFSV
MLVVPLGVIGALLATSMRGLSNDVFFQVGLLTTIGLSAKNAILIVEFAKELHEQGKGIVE
AAVEACRMRLRPIVMTSLAFILGVVPLAISTGAGSGSQHAIGTGVIGGMVTATVLAIFWV
PLFYVVVSTLFKDAASKEQEATEKGH
NT seq 3141 nt   +upstreamnt  +downstreamnt
atgtcgaagtttttcattgaccggcccatcttcgcctgggtgatcgccctggtgatcatg
ctggcgggcggtctgtcgatcctcaagttgccggtcaaccagtacccggccatcgcgccg
ccggcaatcgccatccaggtgagctacccgggggcctccgccgagacggtgcaggacacc
gtggtgcaggtgatcgagcagcagatgaacggtctcgaccatctgcgctacatctcctcg
gagtccaactccgacggcagcatgaccatcaccgtgaccttcgaccagggcaccagccct
gacatcgcccaggtccaggtgcagaacaagctgcagctggccacgccgctcctgccgcag
gaagtgcagcagcagggcatccgcgtgacgaaggcggtgaagaacttcctgatggtggtc
ggcgtcgtctccaccgatggcggcatgacccgggaagacctgtcgaactacatcgtctcc
aacatccaggacccgctgtcgcggacctccggcgtgggcgacttccaggtgttcggctcg
cagtacgccatgcgcatctggctggacccggccaagctcaacagcttccagatgactccg
ggcgacgtgagggcggcgatcgaggcgcagaacgtacagatctcctccggccagttgggc
ggcctgcctgcggtcaagggccagcagctcaacgccaccatcatcggcaagacccgcctg
cagagcgccgagcaattcaaggagatcctcctcaaggtcaacgccgacggctcccaggtt
cgcctgaaggacgtcgccgacgtcgccctgggcggccaggactacagcatcaacgcccag
ttcaacggcaagccggcctcgggtatcgcgatcaaactggccaccggcgccaacgcgctg
gacaccgccaaggcgatccgctccaccctgggcaccctggagccgttcttcccgcagggc
atgaagatcgtctacccgtacgacaccaccccggtggtttccgcctccatccatgaggtg
gtgaagaccctgggcgaagcgatcctgctggtgttcctggtgatgtacctgttcctgcag
aacttccgcgccacgctgatcccgacgatcgccgtgccggtggtgctgctgggcaccttc
ggcgtgctcgccgccttcggcttctcgatcaacaccctgaccatgttcggcatggtgctg
gcgatcggcctgctggtggacgacgccatcgtcgtggtggaaaacgtcgagcgggtgatg
gccgaggaaggcctgtcgcccagggaggccgcgcgcaagtcgatgggccagatccagggt
gcgctggtgggtatcgccctggtgctgtcggcggtgttcctgccgatggcgttcttcggc
ggctccaccggggtgatctatcggcagttctccatcaccatcgtctcggcgatggccctg
tcggtgctggtggccctggtcctcaccccggcgctttgcgccaccatgctcaagcccatc
gagaagggcgaccacggcgagcacaagcgcggcttcttcggctggttcaaccgcatgttc
ctcgccaccacgcacggctacgagcgtggggtggtgtcgatcctcaagcaccgcttcccg
tacctgctgatgtacgtggtgatcctcggcggcatggtctacctgttcacccgcatcccc
accgcgttcctccccgacgaggaccagggcgtactgttcgcccaggtgcagacgccggcg
ggctcgtccgccgagcggacccaggtggtggtcgacgcgatgcgttcctacctgctggaa
caggaaagcagcgcggtggcctcggtgttcaccgtgaccggcttcaacttcgctggccgc
ggccagagctcgggtatggcgttcatcatgctcaagccctgggaagagcgtccgggcaag
gagaacagcgtgttcgagctggcccaccgcgcccaggaacacttcttcaccttcaaggat
gcgatggtgttcgccttcgccccgccggcggtgctcgagctgggtaacgccgtgggcttc
gacatcttcctccaggaccaggccggcgtcggccacgaggtgctgatgggcgcgcgcaac
cagttcctcggcctggccgagcgaaaccccgcgctgcagcgcgtgcgtcccaacggcctg
aacgacgagccgcagtacaagctgctgatcgacgacgagaaggccagtgctctggggctg
tcgctggccgacatcaacagcaccctgtccatcgcctggggttcgaactacgtcaacgac
ttcatcgaccgtggccgggtgaagaaggtttacctgcagggtcgtccgaatgcgcggatg
agcccggaagacctggacaagtggtacgtgcgcaacgacaagggcgagatggtcccgttc
agcgccttcgccaccggcgagtggagttatggctcgcccaagctttcgcgctacaacggc
gtaccggcgatggaaatcctcggtgaaccggctatgggccgcagtaccggtgaggcgatg
gcggcggttgaggagatcgtcaagcagttgcccaagggcgtgggctacgcctggaccggc
ctgtcctacgaggagcgcctgtctggctcccaggccccggcgctctatgccctgtcgctg
atcgtggtgttcctctgcctggcagcgctgtacgagagctggtcgattccgttctcggtg
atgctggtggtgccgctgggcgtcatcggtgcgctgctggcgacgtccatgcgcggtctg
tccaacgacgtgttcttccaggtgggcctgttgaccaccatcggcctgtcggcgaagaac
gcgatcctgatcgtcgagttcgccaaggaactgcacgagcagggcaagggcatcgtcgag
gcggccgtcgaggcgtgccggatgcgtctgcgcccgatcgtcatgacctccctggcgttc
atcctcggcgtggtgccgctggcgatctccaccggcgccggctccggcagccagcacgcg
atcggtaccggcgtgatcggcggcatggtcaccgcgaccgtcctggcgatcttctgggtg
ccgttgttctacgtggtggtcagtaccctgttcaaggacgccgcgtccaaggaacaggaa
gccaccgagaaggggcattga

KEGG   Pseudomonas sp. ATCC 13867: H681_04260
Entry
H681_04260        CDS       T02524                                 
Name
(GenBank) hydrophobe/amphiphile efflux-1 (HAE1) family protein
  KO
K18138  multidrug efflux pump
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr01501  beta-Lactam resistance
pdr01503  Cationic antimicrobial peptide (CAMP) resistance
Module
pdr_M00718  Multidrug resistance, efflux pump MexAB-OprM
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    H681_04260
   01503 Cationic antimicrobial peptide (CAMP) resistance
    H681_04260
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pdr02000]
    H681_04260
   01504 Antimicrobial resistance genes [BR:pdr01504]
    H681_04260
Transporters [BR:pdr02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   H681_04260
Antimicrobial resistance genes [BR:pdr01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    H681_04260
SSDB
Motif
Pfam: ACR_tran MMPL SecD_SecF Patched
Other DBs
NCBI-ProteinID: AGI22734
UniProt: M4WSM0
LinkDB
Position
920798..923950
AA seq 1050 aa
MISRFFIERPVFAMVISIVILLAGLVAMRALPVAQYPEIVPPEVSVTASYPGASSQVIAE
TVAAPLEQEINGVEGMIYQLSNSDSSGAMQLTVYFEVGTDPDQATIDVNNKVQAALAKLP
EEVRRQGVKVEKKSSDILQVVTLFSPDNSRDPIFISNYALINVIDDLKRIPGVGDVSQFG
SKDYSMRIWLRPDKLAQYNLTPTDVVNAIREQNSQFAAGSFGQQPMKEPQDFTYMATAQG
RFTDPKEFESVILRSDSTGASLLLKDVARVELGAQDYSLVTSLNGQQNAAFGIYLQPGAN
ALDTAQAVRDHMAVLAKRFPQGIAYKIPYDTTTFVKVSIEEVIHTFIEALILVMVVVFVF
LQNLRATLIPVLAIPVSLVGTFAGMYLLGFSINLLSLFGMVLAIGIVVDDAIVVLENVER
VMRTEKLSPKEAAIKAMEEVTGPIVAIVLVLCAVFIPVGFLGGLAGQMYQQFAITIAVSV
VISGIVALTLSPALCALILKPEHKEPAAPFRWFNRAFERITNGYGAGVQFFLKRAILGLV
LFGGMVGLLIVLFGRVPGSLVPDEDQGYVLNAYFLPPAASLSRTEKLTGDVTHELMKHPA
VADVVTFAGFDILTNGTRSNAGVSFVTLKDWKERNTPELDARNLTHEFMKMGAGQEDGVV
MSFNPPPITGMSTTGGFEAYIQDRSGGTSEQLEEVTTKFLAAAAKRPELAGLNTTFNANV
PQYYIDLDRTKARSLGVAIDDVFTAMQSTFGSYYVNDFTLYGRTWQVSLESEPEFRRKPD
DLSQVFVRSSTGDLVPLTTLVSVKRILGPDSYARFNVFPAAKLLGGPAPGYSSGQALAAM
QEVADQVLGEDYSLAWIGSAYQELATQGSGSTAFIFGLILVFLILAAQYERWTLPLAVVT
AVPFAVFGAILAIWLRGLDNDVYFQVGLVTLIGLAAKNAILIIEFAVLCREEQGMGPVEA
ALEAAKLRFRPIVMTSLAFILGCVPLAISTGAGSASRHSIGTGVIGGMLAATLLATFLIP
MFYMLVESAADKLSARKNKDKPVEGGAHEA
NT seq 3153 nt   +upstreamnt  +downstreamnt
gtgatttcgcgcttcttcatcgagcgtcccgtattcgcgatggtgatctccatcgtgatc
ctgctcgcaggcctggtggccatgcgcgcattgcccgttgcccagtacccggaaatcgtg
ccgcccgaggtttcggtgaccgcttcctatccgggcgccagctcgcaggtcatcgccgag
accgtggccgcgccgctggagcaggaaatcaacggcgtggagggcatgatctaccagctg
tccaactccgacagtagcggcgccatgcaactgaccgtgtacttcgaggtgggtaccgac
cctgaccaggccaccatcgacgtcaacaacaaggtgcaggccgcgcttgccaaactgcct
gaagaggtgcgccggcaaggggtgaaggtggagaagaaatcctccgacatcctgcaggtg
gtgaccctgttctccccggacaactcccgcgatccgatcttcatcagcaactacgcgctg
atcaacgtgatcgacgacctcaagcggattcccggcgtcggtgacgtcagccagttcggt
tccaaggactactccatgcgcatctggctgcgcccggacaagctggcgcagtacaacctg
acacccaccgacgtggtgaacgcgatccgcgagcagaactcgcagttcgccgccggcagc
ttcggccagcagccgatgaaggagccgcaggacttcacctacatggccaccgctcagggc
cgcttcaccgatcccaaggagttcgaaagcgtcatcctgcgcagcgattccaccggcgcc
agcctgttgctcaaggacgtggcgcgggtcgaactgggggcgcaggactattccctggtg
acgtccctgaacggccagcagaacgccgccttcggcatctacctgcaaccgggggccaac
gcgctggataccgcccaggccgtgcgtgaccacatggcggtcctggccaagcgtttcccg
caaggcatcgcctacaagatcccgtacgacaccacgaccttcgtgaaggtctccatcgag
gaggtgatccacaccttcatcgaggcgctgatcctggtcatggtggtggtcttcgtcttc
ctgcagaacctgcgcgccacgctgatcccggtgctggcgatcccggtgtcgctggtcggc
accttcgccggcatgtacctgctgggcttctccatcaacctgctgtcgctgttcggcatg
gtgctggcgatcggcatcgtggtggacgacgccatcgtggtactggagaacgtcgagcgg
gtcatgcgcaccgaaaagctcagtccgaaggaagcggcgatcaaggcgatggaagaggtg
acagggccgatcgtcgccatcgtgctggtgctctgtgcggtgttcatcccggtcggcttc
ctcggtggcctggccggccagatgtaccagcagttcgcgatcaccatcgcggtgtcggtg
gtgatttccggcatcgtcgccctgacgctctcgcccgcgctctgcgcgctgatcctcaag
cccgagcacaaggagccggcggcgccgttccgctggttcaaccgcgccttcgagcgcatc
accaacggctacggcgcgggtgtgcagttcttcctcaagcgggccatcctcggcctggta
ctgttcggcggcatggtcggcctgctgatcgtcctgttcggccgggtgcccggctcgctg
gtgcctgacgaagaccagggctacgtgctcaacgcctacttcctgccgccggcggcctcg
ctgagtcgtaccgagaagctcaccggcgacgtgacccacgagttgatgaagcacccggca
gtcgccgacgtggtgaccttcgccggcttcgatatcctcaccaacggcactcgcagcaac
gccggggtatccttcgtcacgctcaaggactggaaggagcgcaacacgcccgagctggat
gcacgcaacctcacccatgagttcatgaaaatgggtgccggccaggaagacggcgtcgtg
atgtccttcaacccgccgccgatcaccggcatgagtactaccggcggcttcgaggcctac
atccaggaccgcagtggcggcacctccgagcagttggaggaggtgaccacgaagttcctc
gccgccgccgccaagcggccggaactggcggggttgaataccaccttcaacgccaatgtg
ccgcagtactatatcgacctcgaccgcaccaaggcccgctcgctgggcgtggcgatcgac
gatgtgttcaccgcgatgcagtcgaccttcggcagctactacgtcaacgacttcaccctg
tatgggcgtacctggcaggtttccctggagtcggagccggagttccgccgcaagccggac
gacctgagccaggtcttcgtgcgttcgtccacgggggatctggtgccgctgaccacgctg
gtgtcggtcaagcgtatcctcggcccggactcctacgcccgcttcaacgtcttcccggcg
gccaagctgctcggcggcccggccccgggctacagctccggccaggcgctggcggcgatg
caggaagtggcggaccaggtactgggtgaagactactcgctggcctggatcggttcggcc
taccaggaactggcgactcagggctcgggcagtaccgcgttcatcttcggcctgatcctg
gtgttcctcatcctcgctgcccagtacgagcgctggaccctgccgctggccgtggtcact
gcggtgcccttcgcggtgttcggggcgatcctggcgatctggctgcgcgggctggataac
gacgtgtacttccaggtcggcctggtgaccctgatcggcctggcggcgaagaacgccatc
ctgatcatcgagttcgccgtgctgtgccgcgaagagcagggcatgggaccggtggaggcg
gcgctggaggcagccaagctgcgcttccgtcccatcgtgatgacctcgctggccttcatc
ctgggctgcgtgccgttggccatcagcaccggcgccggctccgcgagccgtcactcgatc
ggtaccggggtgatcggcgggatgcttgccgcgacgctgctggcgaccttcctcatcccg
atgttctacatgctggtggagtccgcggccgacaagctttccgctcgcaagaacaaggac
aagcccgtggagggcggggcccacgaggcctga

KEGG   Pseudomonas sp. ATCC 13867: H681_20560
Entry
H681_20560        CDS       T02524                                 
Name
(GenBank) multidrug efflux protein
  KO
K18138  multidrug efflux pump
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr01501  beta-Lactam resistance
pdr01503  Cationic antimicrobial peptide (CAMP) resistance
Module
pdr_M00718  Multidrug resistance, efflux pump MexAB-OprM
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    H681_20560
   01503 Cationic antimicrobial peptide (CAMP) resistance
    H681_20560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pdr02000]
    H681_20560
   01504 Antimicrobial resistance genes [BR:pdr01504]
    H681_20560
Transporters [BR:pdr02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   H681_20560
Antimicrobial resistance genes [BR:pdr01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    H681_20560
SSDB
Motif
Pfam: ACR_tran MMPL SecD_SecF
Other DBs
NCBI-ProteinID: AGI25979
UniProt: M4X1K7
LinkDB
Position
4600287..4603343
AA seq 1018 aa
MFTDPFIRRPVLATVVSLLIVLLGMQAFSKLVIREYPQMENALITVTTFYAGANAETIQG
YITQPLQQSLASAEGIDYMTSVSRQNYSVISIYAHIGANTDRLVTELLSKIGEVKTQLPP
DAEDPVLDKEAADASALMYISFFSEQMNNPQITDYLSRVVQPKLATLPGIAEAEILGNQV
FAMRLWLNPVKMAAYGITAGDIDNAVRQYNFLSAAGEVKGELVVTSVNASTDLKSPEAFA
AIPLKTEGDRRVLMSDVARIELGAASYDAVSSFNGIPSVYIGIKGTPSSNPLDVIKEVRA
KMPELEEQLPPGLQVSIAYDATRFIQASIDEVVKTLGEAILIVIVVVFLFLGALRSVIIP
VVTIPLSMIGVLFFMQMMGYSINLLTLLAMVLAIGLVVDDAIVVVENIHRHIEEGKTPFQ
GAIEGAREIAVPVVTMTITLAAVYAPIGFLSGLTGALFKEFAFTLAGAVIISGIVALTLS
PMMCSRLLRHDENPSGLAHRLDLIFEGLKVRYQRALHGTLNSRPVVIVFAALVLAIIPLL
MMFTHKELAPEEDQGIVFIMANAPQTANLDYLSKYTAEFEDIFRKFPEYYSAFQINGYNG
VQTGIGGMLLKPWDERERSQMELLSAVQAELDKIPGLQIFGFNLPSLPGTGEGLPFQFVI
NTASDYQSLLQVVERVKKRAEESGKFAFLDLDLAFDKPELVVDIDRAKAAQMDVTMQDLG
VSLGALLGEGEINRFTIDGRSYKVIAQVERAYRDNPGWLSNYYVKSRGGQLISLSTLVTF
HERARPRQLNQFQQLNSAIISGVPMVSMGEAIDTVRGIAEQESPRGFSFDYAGASRQFVQ
EGSALMITFALALAVIFLVLAAQFESFRDPLVIMVTVPLSICGALIPLFLGLSSLNIYTQ
VGLVTLIGLISKHGILIVEFANQLRHERGLSVREAVEEAAAIRLRPVLMTTAAMVLGVIP
LLLATGAGAVSRFDIGIVIATGMSVGTLFTLFVLPCVYTLLAKPDPKPVGDNAPASAH
NT seq 3057 nt   +upstreamnt  +downstreamnt
atgttcaccgatccctttatccgtcgcccggtgttggcgaccgtggtcagcctgctgatc
gtcctgctcggcatgcaggccttcagcaagctggtgatccgcgaatacccgcagatggaa
aacgcgctgatcaccgtcaccaccttctacgccggggccaacgccgagaccatccagggc
tacatcacccagccgctgcagcagagcctggccagcgccgaaggcatcgactacatgacc
tcggtgagccggcagaactactcggtgatctcgatctacgcgcacatcggcgccaacacc
gaccgcctggtgaccgagctgctgtcgaagatcggcgaggtgaagacccagttgccgccc
gacgccgaagacccggtgctggacaaggaagccgccgacgcctcggcgctgatgtacatc
agcttcttcagcgagcagatgaacaacccgcagatcaccgactacctgtcgcgcgtggta
cagcccaagctggccaccctgccgggcatcgccgaggccgagatcctcggcaaccaggtc
ttcgccatgcgcctgtggctgaacccggtgaagatggccgcctatggcatcaccgcaggg
gacatcgacaacgcggtgcgccagtacaacttcctctccgccgccggcgaggtgaagggc
gagctggtggtcacctcggtgaacgcctccaccgacctgaaatccccggaagccttcgcc
gccatcccgctcaagaccgagggcgaccgccgcgtgctgatgagcgacgtggcgcgcatc
gaactgggcgcggcgagctacgacgcggtcagctcgttcaacggaatcccctcggtgtac
atcggcatcaagggcacgcccagctccaacccgctggacgtgatcaaggaagtccgcgcc
aagatgcccgagctggaagagcaactgccgccgggcctgcaggtatccatcgcctacgac
gccacgcgcttcatccaggcgtccatcgacgaggtagtgaagaccctgggcgaggcgatc
ctgatcgtcatcgtggtggtcttcctgttcctcggcgcgctgcgctcggtgatcatcccg
gtggtgaccatcccgctgtcgatgatcggcgtgctgttcttcatgcagatgatgggctac
tcgatcaacctgctgaccctgctggcgatggtgctcgccatcggcctggtggtggacgac
gccatcgtggtggtggagaacatccaccgccacatcgaggagggcaagacgccgttccag
ggcgccatcgagggcgcgcgggaaatcgccgtgccggtggtgaccatgaccatcaccctg
gccgccgtgtacgcgcccatcggcttcctcagcggcctcaccggcgcgctgttcaaggag
ttcgccttcaccctggccggtgcggtgatcatctccggcatcgtagccctgacgctgtcg
ccgatgatgtgctcgcgcctgctgcgccacgacgagaaccccagcggcctggcccatcgc
ctggacctgatcttcgagggcctgaaggtgcgctaccagcgcgccctgcacggcaccctg
aacagccgtccggtggtgattgtcttcgccgcgctggtgctggcgatcatcccgctgctg
atgatgttcacccacaaggaactggccccggaggaagaccagggcatcgtcttcatcatg
gccaacgcgccgcagaccgcgaacctggactacctatccaagtacaccgccgagttcgag
gacattttccgcaagttccccgagtactattcggcgttccagatcaacggctacaacggc
gtgcagaccggtatcggcggcatgctgctcaagccctgggacgagcgcgagcgcagccag
atggagctgctctcggcggtacaggcagaactggacaagatccccggcctgcagatcttc
ggcttcaaccttccgtcgctgccgggcaccggcgagggcctgccgttccagttcgtgatc
aacaccgccagcgactaccagtcgctgctgcaggtggtcgagcgggtgaagaaacgcgcc
gaggaatcgggcaagttcgccttcctcgacctcgacctggcgttcgacaagccggaactg
gtggtcgacatcgaccgtgccaaggccgcgcagatggacgtcaccatgcaggacctgggc
gtctccctgggcgcgctgctgggcgagggcgagatcaaccgcttcaccatcgacgggcgc
agctacaaggtgatcgcccaggtcgagcgcgcctaccgcgacaatccgggctggctgagc
aactactacgtgaagagccggggcggccagctgatctcgctgtccaccctggtgaccttc
cacgagcgcgcgcggccgcgccagctcaaccagttccagcagctcaactcggcgatcatc
tccggcgtgccgatggtcagcatgggcgaggccatcgacacggtgcgcggcatcgccgag
caggaatcgccgcgcggcttctccttcgactacgccggcgcctcgcggcaattcgtgcag
gaaggcagcgcgctgatgatcaccttcgccctcgcgctggcggtgatcttcctggtgctg
gcggcgcagttcgagagcttccgcgatccgctggtgatcatggtcaccgtgccgctgtcg
atctgcggcgcgctgatcccgctgttcctcggcctgtcgagcctgaacatctatacccag
gtgggcctggtgacgctgatcggcctgatcagcaagcacggcatcctcatcgtcgagttc
gccaaccagctgcgccacgagcgcgggttgtcggtgcgcgaggcggtggaggaagccgcg
gcgatccgcctgcgcccggtgctgatgaccaccgccgcgatggtgctgggggtaatcccg
ctgctgctcgccaccggcgccggcgcggtgagccgcttcgacatcggaatcgtgatcgcc
accggcatgagcgtgggcacgctgttcaccctgttcgtgctgccgtgcgtgtacacgctg
ctggccaagccggacccgaagcccgtcggagacaacgccccggcctcggcgcactga

DBGET integrated database retrieval system