KEGG   Pseudomonas sp. ATCC 13867: H681_01940
Entry
H681_01940        CDS       T02524                                 
Name
(GenBank) outer membrane protein OprM
  KO
K18139  outer membrane protein, multidrug efflux system
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr01501  beta-Lactam resistance
pdr02024  Quorum sensing
Module
pdr_M00642  Multidrug resistance, efflux pump MexJK-OprM
pdr_M00718  Multidrug resistance, efflux pump MexAB-OprM
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    H681_01940
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    H681_01940
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pdr02000]
    H681_01940
   01504 Antimicrobial resistance genes [BR:pdr01504]
    H681_01940
Transporters [BR:pdr02000]
 Other transporters
  Pores ion channels [TC:1]
   H681_01940
Antimicrobial resistance genes [BR:pdr01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    H681_01940
   Multidrug resistance, efflux pump MexJK-OprM [MD:M00642]
    H681_01940
   Multidrug resistance, efflux pump MexXY-OprM [MD:M00643]
    H681_01940
SSDB
Motif
Pfam: OEP
Other DBs
NCBI-ProteinID: AGI22270
UniProt: M4XA85
LinkDB
Position
428927..430375
AA seq 482 aa
MRKSLLSLAIAAGVLSGCSLIPDYERPEAPVAGAYPQGDAYVAAQPANAGADIGWREFFK
DPQLQRLIEVSLENNRDLRVAALNIEAYRAQYRIQRADLFPAVDAGINGSRQRLPADLST
TGNSMISSQYGATLGVTSWELDLFGRLRALRDQALETYFASEEARRSTQTSLVANVANAY
LTLRADQAQLKLTRDTLGTYQKSYDLTKRSYDVGVASALDLRQAQTSVESARATLAQYTR
LVAQDQNALVLLLGSGLPADLPQGRELSEELLATVPAGLPSDLLQRRPDILQAEHQLKAA
NANIGAARAAFFPNISLTANAGSLSPDLSGLFDAGSGSWLFQPSISLPIFNAGALRASLD
LAKVQKDINVAQYEKAIQTAFSEVADGLAARGTFGEQLQAQRSLVDASSEYYRLADKRYR
TGVDNYLTLLDAQRSLFSAQQQLISDRLNQLTSEVNLYKALGGGWQATAAEAKPISSEAP
KG
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgagaaagtccttactgtccctcgcgatagccgccggcgtgttgtccggctgctcgctg
atccccgactacgagcgccccgaggcgcccgtggcgggggcctatccgcagggcgatgct
tacgtggcggcgcaaccggccaacgccggcgccgacatcggctggcgcgagttcttcaag
gacccgcaactgcagcggctgatcgaagtgtcgctggaaaacaaccgtgacctgcgcgtc
gccgcgctgaacatcgaagcctaccgggcgcagtaccgcatccagcgggccgacctgttc
ccggcggtggacgccggcatcaacggctcgcgccagcgcctgccggccgacctgtcgacc
accggcaactcgatgatcagcagccagtacggcgcgaccctgggcgtcacctcctgggag
ctcgacctgttcggtcgcctgcgcgccctgcgtgaccaggcgctggaaacctacttcgcc
agcgaagaggcccgtcgcagcacccagaccagcctggtggccaacgtcgccaacgcctac
ctgaccctgcgcgccgaccaggctcaactgaagttgacccgcgacaccctgggcacctac
cagaagagctacgacctgaccaagcgcagctacgacgtcggcgtcgcctcggcgctggac
ctgcgccaggcgcagacctcggtggaaagcgcgcgggccaccctggcgcagtacacccgc
ctggtcgcccaggaccagaacgccctggtgctgctgctcggctccggcctgccggcggac
ctgccgcaaggccgcgagctgtccgaagagttgctggccaccgtgccggcagggctgccg
tccgacctgctgcagcgtcgcccggacatcctccaggccgagcatcagctcaaggcggcc
aatgccaacatcggcgcggcgcgcgcggcgttcttcccgaacatcagcctgaccgccaat
gccggcagcctcagcccggacctctccggcctgttcgatgccggctccggcagctggctg
ttccagccgtccatcagcctgccgatcttcaacgccggcgccctgcgcgccagcctggac
ctggccaaggtgcagaaggacatcaacgtggcgcagtacgagaaagccatccagacggcc
ttctccgaggtcgccgacggcctcgccgcccgtggcaccttcggcgagcaactgcaggcg
cagcgctcgctggtggacgccagcagcgagtactaccgcctggccgacaagcgctaccgc
acgggtgtggacaactacctgaccctgctcgatgcgcagcgttcgctgttcagtgcccag
cagcaactgatcagcgaccggctgaaccagctgaccagcgaggtgaacctgtacaaggcc
ctcggcggcggttggcaggccacggcggcggaagcaaagccgatctccagcgaagcgccc
aaaggctga

KEGG   Pseudomonas sp. ATCC 13867: H681_12955
Entry
H681_12955        CDS       T02524                                 
Name
(GenBank) outer membrane efflux protein
  KO
K12340  outer membrane protein
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr01501  beta-Lactam resistance
pdr01503  Cationic antimicrobial peptide (CAMP) resistance
pdr02020  Two-component system
pdr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    H681_12955
  09132 Signal transduction
   02020 Two-component system
    H681_12955
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    H681_12955
   01503 Cationic antimicrobial peptide (CAMP) resistance
    H681_12955
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pdr02000]
    H681_12955
   02044 Secretion system [BR:pdr02044]
    H681_12955
   01504 Antimicrobial resistance genes [BR:pdr01504]
    H681_12955
Transporters [BR:pdr02000]
 Other transporters
  Pores ion channels [TC:1]
   H681_12955
Secretion system [BR:pdr02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter
   H681_12955
  RTX toxin transporter
   H681_12955
  Multiple protein transporter
   H681_12955
  RaxAB-RaxC type I secretion system protein
   H681_12955
Antimicrobial resistance genes [BR:pdr01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump AcrEF-TolC [MD:M00696]
    H681_12955
   Multidrug resistance, efflux pump MdtEF-TolC [MD:M00697]
    H681_12955
SSDB
Motif
Pfam: OEP
Other DBs
NCBI-ProteinID: AGI24461
UniProt: M4WYY4
LinkDB
Position
2922034..2923575
AA seq 513 aa
MPAYALKCLSATIAATVVLTACSSFQPKPYTQDEMRQRVIEDQARMYKEQEPVNGPITFY
EASARALKYNLDYRLKLLESALASDLRDVTSHEMLPRLVASAGYAGRNNDSGGTSIGIED
RQVSLRPSTSEERYRTLYSLGLSWSLLDFGVAYYRTQQKNDQMLMAEERREKVAQNVLQD
VRNAYWRALGAQRLLPEVDGLLMRTHRALTAAREAENQGLLPRQDILAYQRALLDSVYML
TVRRQDLEFARAELAALMSLPPNTRMVLADVSEQPLPLVTSNTEQLERLSLEHRPEIMEE
WYRKRVDMNDLKIAKAQLWPNLSFNYGYEYDSNKYLYNNDWNQTGVQVSMNLLRLLQYPD
IKAAEESQEKTDDMRRTALSMAILTQVRVGLLRYQLARQEVEFANESLRVDKSLLDYAQS
ARGAALGSELELIRAEGRYLLSRYQREAAYSDAQAAWGRLYNSVGFEVMPKEIENHDIKT
LAREIQRTLDQQSSSNLLASSLSSSEGSANVAQ
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgcccgcatacgccctgaaatgcctgagtgccacgatcgccgccactgtcgttctgacg
gcctgttcgtcattccagcccaagccctatacccaggatgaaatgcgacagcgggtcatc
gaagaccaggcgcggatgtacaaggaacaggagccggtgaacggtccgatcaccttctac
gaagcctccgcccgagcgttgaaatacaacctcgactaccgcctcaagctgctggaaagc
gcgctggcatcagacctgcgcgacgtcaccagccacgagatgctgccgcgcctggtggcc
tcggccggctacgccgggcgcaacaacgattcgggcggcacctccatcggcatcgaggac
cgccaggtcagcttgcgcccatccacctccgaggagcgctaccgcacgctgtacagcctg
ggactgtcctggagcctgctggacttcggcgtcgcctactaccgcacccagcagaagaac
gaccagatgctgatggccgaggaacgccgcgagaaggtcgcgcagaatgtcctgcaggac
gtgcgcaacgcctactggcgcgccctgggcgcccagcgcctgctgccggaagtggacggc
ctgctgatgcgcacccaccgcgccctgaccgccgcccgcgaggcggaaaaccagggcctg
ctgccgcgccaggacatcctcgcctaccagcgcgccctgctcgactcggtatacatgctc
accgtgcgccgccaggacctggagttcgcccgcgccgaactggccgcgctgatgtcgctg
ccgcccaacaccaggatggtgctggccgacgtcagcgaacagccgctgccgctggtcacc
agcaacaccgagcaactggagcgcctgtccctggagcaccgtccggaaatcatggaagag
tggtacagaaagcgcgtcgacatgaacgacctgaagatcgccaaggcgcagctgtggccc
aacctgagcttcaactacggctacgagtacgactccaacaagtacctgtacaacaacgac
tggaaccagaccggcgtccaggtctcgatgaacctcctgcgcctcttgcagtacccggac
atcaaggccgccgaagagagccaggagaagaccgacgacatgcgccgcaccgcactgtcg
atggccatcctcacccaggttcgcgtcggcctgctgcgctaccagctggcgcgccaggaa
gtggagttcgccaacgaaagcctgcgggtcgacaagagcctgctcgactacgcccagtcc
gcccgtggcgccgccctgggcagcgagctggagctgatccgcgccgaaggccgctacctg
ctctcgcgctaccagcgcgaagccgcctactccgacgcccaggccgcctggggccggctg
tacaactcggtgggcttcgaggtgatgcccaaggaaatcgagaaccacgacatcaagacg
cttgcgcgggaaatccaacgcacgctcgatcagcagtccagcagcaacctgctcgccagc
agcctctccagcagtgaaggaagcgccaatgtcgcgcagtaa

KEGG   Pseudomonas sp. ATCC 13867: H681_15560
Entry
H681_15560        CDS       T02524                                 
Name
(GenBank) outer membrane efflux protein
  KO
K12340  outer membrane protein
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr01501  beta-Lactam resistance
pdr01503  Cationic antimicrobial peptide (CAMP) resistance
pdr02020  Two-component system
pdr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    H681_15560
  09132 Signal transduction
   02020 Two-component system
    H681_15560
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    H681_15560
   01503 Cationic antimicrobial peptide (CAMP) resistance
    H681_15560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pdr02000]
    H681_15560
   02044 Secretion system [BR:pdr02044]
    H681_15560
   01504 Antimicrobial resistance genes [BR:pdr01504]
    H681_15560
Transporters [BR:pdr02000]
 Other transporters
  Pores ion channels [TC:1]
   H681_15560
Secretion system [BR:pdr02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter
   H681_15560
  RTX toxin transporter
   H681_15560
  Multiple protein transporter
   H681_15560
  RaxAB-RaxC type I secretion system protein
   H681_15560
Antimicrobial resistance genes [BR:pdr01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump AcrEF-TolC [MD:M00696]
    H681_15560
   Multidrug resistance, efflux pump MdtEF-TolC [MD:M00697]
    H681_15560
SSDB
Motif
Pfam: OEP
Other DBs
NCBI-ProteinID: AGI24980
UniProt: M4XI55
LinkDB
Position
complement(3516587..3517966)
AA seq 459 aa
MGPSAVLLAGAFMLAAGGALAQTVAATPAGVSVSTDSTDLMQLYREARLEDPKVLASFAQ
AQAGREHQREAMGALLPQVSLNAGTNRIHQESDLVQDSYDSESYSLVLRQYLYNKAAWEN
YQKFKSLARQTESAALDAQAEATVELARRYFTALAAEDELELVRAERQTTQESLDRVNAL
YEKQLALITDQLDLKARVDLLAAQELEAGNQAIISREALAEIVGRPVKERLSRVRDDVHL
RVSAQSLENWVREGIAQNPALKASESGVEAAGAALRSGKGGHYPTLSLSLSAQQTNEGYN
NALAPRTDSYVAGVGIQVPIYSGGSTSARVRGLYQDQLAAEEQLEEIRRRVVKEITSAYL
TANSNGEKIEANRLALSSAQLSRVAAEKGLSYGMVNAVDVLAAVRNEFRARRDLLKTQYE
FLSNVFTLNRWAGKPPVESVESVNGWLSPGVPRQAFQHP
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgggcccatcggcggttctgctggcgggtgcgttcatgcttgcggcgggaggcgccctg
gcgcaaaccgttgcggcaacgccggctggcgtcagtgtttcgacggattccaccgacctc
atgcagctgtatcgcgaggcgcggctggaggatccgaaagtcctcgcatcctttgcgcaa
gcgcaggcgggccgggaacatcagcgcgaggcaatgggcgcgttgctgccgcaggtatcg
ctcaacgccgggacaaaccggattcaccaggaaagcgacctggtgcaggacagttacgat
agcgagagctacagcctggtgctgcgccagtacctctacaacaaggccgcgtgggagaac
tatcagaagttcaagagcctggcccggcagaccgaatcggcggcgctggatgcccaggcg
gaggccaccgtggagttggcgcggcgttatttcacggcattggcggccgaggatgagctg
gaactggtgagggcggagcggcaaaccacgcaggaaagcctggatcgggtcaacgcgttg
tacgagaagcagctggcgctgattaccgaccagctcgacctcaaggccagggtggacttg
ctggcggcgcaggaactggaggctggcaaccaggccatcatcagtcgcgaggcgctggcg
gagatcgtcgggcgaccggtcaaggagcggctcagtcgggtgcgcgatgacgtgcatctg
cgggtttcggcgcagagtctggaaaactgggttcgcgaaggcatcgcgcagaacccggcg
ctcaaggccagtgaaagcggcgtcgaagccgcgggcgcggcgttgcgcagcggcaagggc
gggcactacccgaccctgagcctgagcctgagcgcacagcagaccaacgagggctacaac
aatgccctggcgccgcgcacggacagttacgtcgccggagtcggcattcaggtgccgatc
tacagcggcggctcgacgtcggcgcgggtccgtgggctctaccaggatcaactggccgcc
gaggagcagttggaggagatccgtcgccgggtggtcaaggagatcaccagcgcttacctg
accgccaattccaatggcgaaaagatcgaggcgaaccggctggccctgtcctcggcgcaa
ctgtcacgggtggcggcggagaaagggctgagctacggcatggtcaatgccgtcgacgta
ctggccgccgtacgcaacgagttccgcgctcggcgggacctgctcaagacgcaatacgaa
tttctcagcaatgtattcaccctcaatcgctgggcgggaaaaccaccggtcgaaagcgtc
gaaagcgtgaatggttggctgagtcccggcgttccccgccaggccttccagcatccctga

KEGG   Pseudomonas sp. ATCC 13867: H681_22315
Entry
H681_22315        CDS       T02524                                 
Name
(GenBank) outer membrane protein
  KO
K12340  outer membrane protein
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr01501  beta-Lactam resistance
pdr01503  Cationic antimicrobial peptide (CAMP) resistance
pdr02020  Two-component system
pdr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    H681_22315
  09132 Signal transduction
   02020 Two-component system
    H681_22315
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    H681_22315
   01503 Cationic antimicrobial peptide (CAMP) resistance
    H681_22315
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pdr02000]
    H681_22315
   02044 Secretion system [BR:pdr02044]
    H681_22315
   01504 Antimicrobial resistance genes [BR:pdr01504]
    H681_22315
Transporters [BR:pdr02000]
 Other transporters
  Pores ion channels [TC:1]
   H681_22315
Secretion system [BR:pdr02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter
   H681_22315
  RTX toxin transporter
   H681_22315
  Multiple protein transporter
   H681_22315
  RaxAB-RaxC type I secretion system protein
   H681_22315
Antimicrobial resistance genes [BR:pdr01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump AcrEF-TolC [MD:M00696]
    H681_22315
   Multidrug resistance, efflux pump MdtEF-TolC [MD:M00697]
    H681_22315
SSDB
Motif
Pfam: OEP RuBisCO_large DUF4240
Other DBs
NCBI-ProteinID: AGI26330
UniProt: M4XM60
LinkDB
Position
4989547..4991001
AA seq 484 aa
MLRRLSLAVAVAASTGFAWAAQPAPAASSLPTKTDLISVYKDAVDNNADLAAAQADYLAR
KEAVPQARSGLLPQINAGANVGSTRTSLDEPNATLNRNNQVVQATLSQPLFRADRWFQLK
AAENISEQAQLEFSSTQQALILQSAVTYFGVLRAQDNLAASKAEEAAFKRQLDQSNERFD
VGLSDKTDVLESQASYDTARANRLVAEQQVDDAFQALVTLTNREYSSLEGILHSMPVVAP
MPNDAKAWVDTSVQQNLALQASNYAVDAAEETLRQRKAGHLPTVDAVAQYQKGDNDALGF
ANSGAPGDPHYGKWVDQSSIGLQLNVPIYSGGLTSSQVREAYQRLNQSEQLRESQRRQVV
QDARNQHRAVNTDVEQVKARRQAIISNQSSLEATEIGYQVGTRNIVDVLDAQRSLYSAVR
DYNNTRYDYILDNLRLKQTAGTLAPSDLQALSGYLKPDYNPDKDFLPPDLAKAAEAQLKN
SSQY
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgctgcgcagactctccctggctgtcgccgtggccgcttcgacaggctttgcctgggcc
gcacagcccgctccggcggcctcctcgctgccgaccaagacggacctgatcagcgtctat
aaagacgccgtcgacaacaacgccgacctcgccgccgcgcaggccgactacctggcccgc
aaggaagccgtgccgcaggcgcgttccgggttgctgccgcagatcaacgccggcgccaac
gtgggcagcacccgcacctcgctggacgagcccaatgcgacgctgaaccgcaacaaccag
gtggtccaggcgaccctgagccagccgctgttccgtgccgaccgctggttccagctcaag
gcagcggagaacatcagcgaacaggcccagctggaattctcctcgacccaacaggcgctg
atcctgcagagcgccgtgacctatttcggcgtgctccgcgcccaggacaacctggccgcc
agcaaggccgaggaagcggccttcaagcgccagctcgaccagtccaacgaacgtttcgac
gtcggcctgtcggacaagaccgacgtgctcgaatcccaggccagctacgacaccgcccgc
gccaaccgcctggtcgccgaacagcaggtggatgatgccttccaggccctggtcaccctg
accaaccgcgagtacagctccctcgaaggtatcctgcactccatgccggtggtcgcgccg
atgcccaacgacgccaaggcctgggtagacacctcggtacagcagaacctggcgttgcag
gccagcaactacgcggtcgacgccgccgaagaaaccctgcgccagcgcaaggccggccac
ctgccgaccgtcgatgccgtggcgcaataccagaaaggcgacaacgacgccctgggcttc
gccaactccggcgcccccggtgatccgcactacggcaaatgggtcgaccagagcagcatc
ggcctgcagttgaacgtgccgatctacagcggcggcctgaccagttcccaggtccgcgag
gcctaccagcgcctgaaccagagcgagcaactgcgcgaaagccagcgccgccaggtggtg
caggacgcccgcaaccagcaccgcgcggtgaacaccgacgtggagcaggtcaaggcgcgg
cgccaggcgatcatctccaaccagagctcgctggaagccaccgagatcggctaccaggtc
ggtacccgcaacatcgtcgacgtactggacgcccagcgttcgctgtacagcgccgtgcgc
gactacaacaacacccgctacgactacatcctcgacaacctgcgcctgaagcagaccgcc
ggcaccctggcgccgagcgacctgcaggccctgagcggttacctgaagccggactacaac
ccggacaaggacttcctgccgccggacctggccaaggccgccgaagctcagctgaagaac
agctcccaatactga

DBGET integrated database retrieval system