KEGG   Pseudomonas sp. ATCC 13867: H681_03635
Entry
H681_03635        CDS       T02524                                 
Name
(GenBank) ATP-dependent RNA helicase
  KO
K11927  ATP-dependent RNA helicase RhlE [EC:3.6.4.13]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    H681_03635
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdr03019]
    H681_03635
Enzymes [BR:pdr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     H681_03635
Messenger RNA biogenesis [BR:pdr03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     H681_03635
SSDB
Motif
Pfam: DEAD Helicase_C ResIII AAA_19 CMS1 SNF2-rel_dom
Other DBs
NCBI-ProteinID: AGI22609
UniProt: M4WS99
LinkDB
Position
781847..783223
AA seq 458 aa
MTFATLGLIDPLLRALDGLGYQNPTAVQAQAIPAVLKGRDLLAAAQTGTGKTAGFALPLL
QKLLQEGPQVAANSIRALVLVPTRELAEQVHESFRAYGQHVPLRTAVAYGGVSINPQMMK
LRKGVDVLVATPGRLLDLYRQNALKFTQLQALVLDEADRMLDLGFARELDEVFAALPRRR
QTLLFSATFSDAIRQMARTLLLDPLTIDVAPRNTAAKTVKQHLLTVDKKRKAELFLHLLR
EQGWRQALVFAKTRKGVDELVDLLQREGIRADSIHGDKPQPSRLRALARFKAGEVDFLVA
TDVAARGLDIEEMPLVVNFDLPIVPEDYVHRIGRTGRAGASGQAISLVCADEVQQLAAIE
TLIGQTLQRQEEDGFEAEHRVPVTAPGGQVMKKPKKPKQPKVPEGKPGKVHLGALLDDKP
QVKAVRKAPGFGLGGSRPSAGKPGGAGKPAGKRKPGNR
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgaccttcgccaccctcggcctgatcgaccctctcctgcgcgccctcgacgggctcggc
taccagaacccgacggcggtccaggcccaggccatccccgcggtgctcaagggtcgcgac
ctgctcgccgccgcccagaccggcaccggcaagaccgccggtttcgccctgccgctgttg
cagaagctgctgcaggaaggcccgcaggtggccgccaattccatccgcgcgctggtgctg
gtgccgacccgcgagctggccgagcaggtgcacgagagcttccgcgcctatggccagcac
gtgccgctgcgcaccgccgtggcgtatggcggggtcagcatcaacccgcagatgatgaag
ctgcgcaagggcgtcgacgtgctggtggccacccccggccgcctgctcgacctgtaccgg
cagaacgccctgaaattcacccagttgcaggccctggtgctggacgaagccgaccgcatg
ctcgacctcggtttcgcccgcgagctggacgaagtcttcgccgcgctgcccaggcgccgg
cagaccctgctgttctccgcgaccttctccgacgccatccgccagatggcccgcaccctg
ctgctcgacccgctgaccatcgacgtggcgccgcgcaacacggcggcgaagacggtgaag
cagcacctgctcaccgtggacaagaagcgcaaggccgagctgttcctgcacctgctgcgc
gagcagggctggcgccaggcgctggtgttcgccaagacccgcaagggcgtcgacgaactg
gtcgacctgctgcagcgcgaaggcatccgcgccgactcgatccacggcgacaagccgcag
ccctcgcgtctgcgcgccctggcgcggttcaaggccggcgaggtggacttcctcgtcgcc
accgacgtcgccgcgcgcggcctggacatcgaggaaatgccgctggtggtcaacttcgac
ctgcccatcgtccccgaggattacgtgcaccgcatcggccggaccggccgcgccggtgcc
agcggtcaggcgatctcgctggtctgcgccgatgaagtgcagcagctggcggccatcgag
acgctgatcggccagaccctgcagcgccaggaagaagatggcttcgaggcggagcaccgg
gtgcccgtcaccgcgcccggcggccaggtgatgaagaagccgaagaagcccaagcaaccc
aaggtgcccgagggcaagccgggcaaggtccatctcggcgcgctgctggacgacaagccg
caggtcaaggcggtgcgcaaggcgccgggcttcggcctgggcggcagcaggccgtcggcc
ggaaaacccggcggcgcaggcaagccggccgggaagaggaaaccgggcaaccgctga

KEGG   Pseudomonas sp. ATCC 13867: H681_22795
Entry
H681_22795        CDS       T02524                                 
Name
(GenBank) ATP-dependent RNA helicase
  KO
K11927  ATP-dependent RNA helicase RhlE [EC:3.6.4.13]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    H681_22795
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdr03019]
    H681_22795
Enzymes [BR:pdr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     H681_22795
Messenger RNA biogenesis [BR:pdr03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     H681_22795
SSDB
Motif
Pfam: DEAD Helicase_C ResIII AAA_19
Other DBs
NCBI-ProteinID: AGI26426
UniProt: M4X4D0
LinkDB
Position
5109981..5111999
AA seq 672 aa
MSFSSLGLSEALAGAVEAAGYARPTPVQERAIPAVLQGRDLMVAAQTGTGKTGGFALPVL
ERLFPEGHPDREHRHGPRQARVLVLTPTRELAAQVHDSFKVYARDLPLKSACIFGGVGMN
PQVQAMSKGVDVLVACPGRLLDLIGQGSVDLSRVEILVLDEADRMLDMGFIHDVKKVLAK
LPAKRQNLLFSATFSKDIIDLTNKLLHNPERIEVTPPNTTVERIEQRVFRIPAVQKRVLL
AHLVTVGAWEQVLVFTRTKHGANRLAEYLSKHGLPAAAIHGNKSQNARTKALADFKANDV
RILVATDIAARGLDIDQLPHVVNYELPNVEEDYVHRIGRTGRAGRSGEAISLVAPDEDKL
LKAIERLTKQRIPDGDMQGFDPDAVLPEVQQPEPKEAPQRQPRKDKAKRGERKERTRDKP
QQPQAEEQHNAAPAAVEAAEGDKPAGKRRRRGGRGKKKGDGQGGDAQPNANAQPRQQSQG
RQQQQPKQQARAPKVDPDRDPEEFLDDDFDNFGNRADYVSPFPDKDQPRGQRRRSGQGQG
QGQSQGQGQQQRSRGQGGGQGQGQSQNRGQGQGQGQGKAAKKPGGARGQGQGGSQGKQGQ
RKRGGKAPASRMNDAPLREPSEYGAAKPTRQPVVINKRDLLRTDRFPTAEQLEELEPRRK
TERPALLTRNRE
NT seq 2019 nt   +upstreamnt  +downstreamnt
atgtccttttcctccctcggtctctccgaggccctggctggcgccgttgaagccgccggc
tacgcgcgccccacccccgtccaggaacgcgccatccccgccgtgctccagggccgcgac
ctgatggttgccgcccagaccggcaccggcaagaccggcggcttcgccctcccggtgctc
gagcgcctgtttcccgaaggccaccccgaccgcgaacaccgccacggcccgcgccaggcg
cgcgtgctggtactgaccccgactcgcgaactggccgcccaggtgcatgacagcttcaag
gtctacgcccgcgacctgcccctgaaaagcgcctgcatcttcggcggcgtcggcatgaat
ccccaggtccaggccatgtccaagggcgtcgatgtcctggtcgcctgccccggccgcctg
ctcgatctgatcggtcagggcagcgtcgacctgtcccgcgtggaaatcctcgtcctcgac
gaagccgaccgcatgctcgacatgggcttcatccacgacgtcaagaaggtcctcgccaag
ctgccggccaagcgccagaacctgctgttctcggcgaccttctcgaaagacatcatcgac
ctcaccaacaagctcctgcacaacccggagcgcatcgaggtcaccccgccgaacaccacc
gtcgaacgcatcgaacagcgcgtgttccgcatccccgccgtacagaagcgcgtcctgctg
gcgcacctggtgaccgtgggcgcctgggaacaggtgctggtgttcacccgcaccaagcac
ggcgccaaccgcctcgccgagtacctctccaagcacggcctgccggccgccgcgatccac
ggcaacaagagccagaacgcgcgcaccaaggccctggccgacttcaaggccaacgacgtg
cgcatcctggtcgccaccgacatcgccgcccgcggcctggacatcgaccagttgccccac
gtggtcaactatgaactgcccaacgtcgaggaagactacgtccaccgcatcggtcgtacc
ggccgcgccgggcgtagcggtgaagccatctcgctggtggctccggacgaggacaagctg
ctcaaggccatcgaacgcctgaccaagcagcgcatccccgacggcgacatgcagggcttc
gaccctgacgccgtgctgccggaagtccagcagcccgagccgaaggaggcgccgcagcgc
cagccgcgcaaggacaaggccaagcggggcgagcgcaaggagcgcaccagggacaaaccc
cagcagccgcaggccgaagagcaacacaacgccgctcctgccgcagtcgaagccgccgaa
ggcgacaagccggccggcaagcgccgccgccgtggcggccggggcaagaagaaaggtgat
ggccagggcggcgatgcccagcccaatgccaacgcccaaccgcgccaacagagccagggc
cgccagcagcaacagcccaagcagcaggcgcgcgcaccgaaggtcgatccggatcgcgat
ccggaagagttcctcgacgacgatttcgacaacttcggcaatcgcgccgactacgtcagc
ccgttcccggacaaggaccaaccgcgcggccagcgtcgccgtagcggccaaggccaaggc
caaggacagagccaggggcaaggccaacagcagcgcagccgtggtcagggcggcggtcag
ggtcagggccaaagccagaaccgtggccaggggcaggggcaaggccagggcaaggctgcc
aagaagcccggcggcgctcgcggccagggccagggtggcagccagggcaagcagggccag
cgcaagcgcggcggcaaggcaccggcctcgcgcatgaacgatgccccgctgcgcgagccg
agcgaatacggcgccgccaagccgacccgtcagccggtggtgatcaacaagcgcgacctg
ctccgcaccgaccgcttccctaccgccgagcagttggaagaactggaaccgcgccgcaag
accgagcgtccggcgctgctgacccgcaatcgcgagtga

DBGET integrated database retrieval system