KEGG   Pseudomonas sp. ATCC 13867: H681_04250
Entry
H681_04250        CDS       T02524                                 
Name
(GenBank) putative transcriptional regulator
  KO
K18135  TetR/AcrR family transcriptional regulator, repressor of the mexAB-oprM multidrug resistance operon
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    H681_04250
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pdr03000]
    H681_04250
Transcription factors [BR:pdr03000]
 Prokaryotic type
  Helix-turn-helix
   TetR/AcrR family
    H681_04250
SSDB
Motif
Pfam: TetR_N TetR_C_2 TetR_C_6 TetR_C_11 UPF0122
Other DBs
NCBI-ProteinID: AGI22732
UniProt: M4WVJ1
LinkDB
Position
complement(918814..919446)
AA seq 210 aa
MRRTKEDSEKTRQTILDSAEQIFLAKGVSNTSLEEIARSAGVTRGAVYWHFQNKAHLFNE
LLNQVRLPPEQLAQRLSGCDGHDPIQSLFELSVEVIENLARHPQRRRILTILLQRCEFTD
ELRDAEERHNHFIRQFIELCEQLFTRESCRSRLMPGVSPQIASRAVHAMIFGLLSDWLRD
PELFDAERETRLLFDALFRGLVRDWSAPQT
NT seq 633 nt   +upstreamnt  +downstreamnt
atgcgaagaactaaagaagattcggaaaagacgcgtcagacgatactcgattcagccgag
cagatttttcttgccaaaggcgtctccaacacgagtctggaagagattgcccgaagcgcc
ggcgtgacccgcggcgcggtgtactggcacttccagaacaaggcccatctgttcaacgaa
ctgctcaaccaggtacgcctgccaccggagcaattggcgcagcgtctctccggctgcgac
gggcacgacccgatccagtcgctgttcgaactgagcgtggaagtcatcgagaacctggcg
cgccatccgcagcgccgacgcatcctcaccatcctgctgcaacgctgcgagttcaccgac
gaattgcgcgatgcggaagagcggcacaaccacttcatccgtcagttcatcgaactgtgc
gaacagctgttcacccgcgagagctgccgtagccggctgatgccgggcgtgtctccgcag
atcgcctcgcgcgcggtgcatgcgatgattttcggcctgctcagcgactggctgcgcgac
ccggagctgttcgacgcggagcgggaaacccgcctcctgttcgatgccctgttcagaggg
ctggtgcgcgactggagcgcgccccaaacctga

DBGET integrated database retrieval system