KEGG   Pseudomonas sp. ATCC 13867: H681_04420
Entry
H681_04420        CDS       T02524                                 
Name
(GenBank) peptidoglycan glycosyltransferase
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00550  Peptidoglycan biosynthesis
pdr01100  Metabolic pathways
pdr01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    H681_04420
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    H681_04420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pdr01011]
    H681_04420
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pdr03036]
    H681_04420
Enzymes [BR:pdr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     H681_04420
Peptidoglycan biosynthesis and degradation proteins [BR:pdr01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   H681_04420
Chromosome and associated proteins [BR:pdr03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    H681_04420
SSDB
Motif
Pfam: Transpeptidase PBP_dimer LEM
Other DBs
NCBI-ProteinID: AGI22764
UniProt: M4WSQ0
LinkDB
Position
complement(963063..964796)
AA seq 577 aa
MNIPPSLSHPWRLRLVILLFGLLSAVLCWRLLELQLHQREFLQAHGDARSLRYLKIPAHR
GEITDRRGEPLAVSTPMLTLWANGRELAAAPERWAELANALGQTPAAFAARLQANREREF
FYLERGLPPVVGQAILARKVPGVYAREEYRRFYPASDTTSQVVGFTDIDGHGQEGVEYAF
DSWLSGVPGRRLVLKDLYGRVVKNLQVVRNAKPGKDLALSLDLRLQYLANRELRRALDQF
GAKAGSLVMIDVRTGELLAMANQPSFNPNNRQGLDPAAIRNRALTDVFEPGSTVKPISMC
AALESGRWRPSDQVEVWPGSLRIGHYTIRDVTRSEGRILDLTGILINSSNVGMSKVAFDI
GGQAIHDVMQRMGLGQYTGLGFPGERVGNLPAYPRWRPAETATLSYGYGLSITAVQLAHA
YATLANGGSMMPLSLVRRERAPRPEQVIPEKVAHTVTAMLEQVVESPRGIHRARVPGYHV
AGKSGTARKAATGARGYRENAYRSMFVGFGPVSAPRIAISVMIDEPSRDGYFGGKVAAPV
FSRVMSGALRILEVAPDNLPQPPLHEATEDSRALASG
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgaacattccacccagcctcagccacccctggcgcctgcgcctggtcatcctgctcttc
ggccttctttcggccgtgctctgctggcgcctgctcgaactgcaattgcatcagcgcgag
ttcctgcaggcccatggcgatgcgcgtagcctgcgttatctgaagattcccgcccatcgc
ggcgagatcaccgaccgccggggagagcccctggcggtgagcacgccgatgctcaccctc
tgggccaacggcagggaactggccgcggcccccgagcgctgggcggaactcgccaatgcc
ctgggccaaacgcctgcggccttcgcggcgcgcctgcaggccaaccgcgaacgcgagttc
ttctacctggagcggggcctgccgccggtggtcgggcaggccatcctggcgcgcaaggtg
ccgggcgtctatgcgcgggaagagtatcggcgcttctacccggccagcgatacgacgtcc
caggtggtcggcttcaccgatatcgacggccacggccaggagggcgtggaatatgccttc
gacagttggctgtccggggtgcccggccgacgcctggtgctcaaggacctgtacgggcgc
gtggtgaagaacctgcaggtcgtgcgcaacgccaagcccggcaaggacctggcgttgtcg
ctggacctgcgcctgcaatacctcgccaaccgcgaactgaggcgggcgctggaccagttc
ggcgccaaggccggcagcctggtgatgatcgacgtgcgtaccggtgagttgctggcgatg
gccaaccagcccagcttcaacccgaacaaccgccagggcctggatcccgcggccatccgc
aaccgcgcgctgaccgacgtgttcgagccaggctccaccgtcaagcccatttccatgtgc
gccgccctagaaagcggccgctggcggccgtctgaccaggtcgaagtgtggcccggcagc
ctacgcatcggccactacaccattcgcgacgtgacccgcagcgagggccgcatactcgac
ctcaccggcatcctcatcaactccagcaacgtcggcatgagcaaggtggcgttcgacatc
ggcggccaagccatccacgacgtgatgcaacggatgggcctgggccagtacactggtctg
ggcttccccggcgagcgcgtcggcaacctgccagcctatccgcgctggcggccagcggag
acggccacgctttcgtacggttacggcctgtcgataaccgccgtgcagctggcccacgcc
tatgccaccctggccaatggcgggagcatgatgcccctgtcgctggtgcgccgcgagcgc
gcgccgcgccccgagcaggtcattccggaaaaggtcgcgcacaccgtgacggccatgctc
gaacaggtggtcgaatcgccccgcggcatccatcgcgcccgggtgcccggctatcacgtg
gccggcaagagcggcacagcgcgcaaggccgccaccggtgcgcgcggctaccgggaaaac
gcctaccgctcgatgttcgtcggcttcggcccggtcagcgctccgcgcatcgccatctca
gtgatgatcgacgagcccagccgcgacggctacttcggcggcaaggttgccgcgccggtt
ttcagtcgtgtgatgagtggggccctgcgcattctcgaggttgcgcccgataaccttccg
cagccgccgttgcacgaggcgacagaggattctcgagcactggcgtccggttga

KEGG   Pseudomonas sp. ATCC 13867: H681_05600
Entry
H681_05600        CDS       T02524                                 
Name
(GenBank) peptidoglycan synthetase FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00550  Peptidoglycan biosynthesis
pdr01100  Metabolic pathways
pdr01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    H681_05600
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    H681_05600
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pdr01011]
    H681_05600
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pdr03036]
    H681_05600
Enzymes [BR:pdr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     H681_05600
Peptidoglycan biosynthesis and degradation proteins [BR:pdr01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   H681_05600
Chromosome and associated proteins [BR:pdr03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    H681_05600
SSDB
Motif
Pfam: Transpeptidase PBP_dimer
Other DBs
NCBI-ProteinID: AGI23000
UniProt: M4XCF3
LinkDB
Position
1223743..1225488
AA seq 581 aa
MKNLAGARYPWRFRVVVGLLMTMVAAIAWRIVDLHVIDHDFLKGQGDARSVRHIAIPAHR
GLITDRNGEPLAVSTPVATLWANPKELVLEREKWGFLADALGQSRAALSERLEANADKEF
IYLVRGLTPEQGEGVMAQVKTHRIPGVYSVEEFRRFYPSGEVAAQVVGFTDVDDRGREGV
ELAFDSWLAGVPGKRQVLKDRRGHLIRDVQVTRNAKAGKTLALSIDLRLQYLANRELRNA
LVENGAKAGSLVILDVKTGEVLAMSNQPTYNPNNRRNLQPAMMRNRAMIDVFEPGSTMKP
FSMSAALETGRWKPTDKVEVYPGTLQIGRYTIRDVSRSEGPVLDLTGILIRSSNVGMSKV
AFDIGGEAIYNLMQKVGLGQDTGLGFPGERVGNLPNYREWRKAETATLSYGYGLSVTAIQ
LAHAYSALANNGRSVPLTMVRADRQPDSTQVIPEPVAKTMQGMLQQVVEAPNGVFRAQVP
GYHVAGKSGTARKTATGTKGYAENSYRSLFAGFGPMSNPRYVIVVVIDEPSKAGYYGGLV
SAPVFSKVMSGTLRLMNVPPDNLPATPQQQADAAPAKGGRG
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgaagaatctcgccggagctcgctacccctggcgcttccgcgtcgtcgtcggcctgctg
atgacgatggtggccgccatcgcctggcggatcgtcgacctgcacgtcatcgaccacgat
ttcctcaagggacagggcgatgcgcgcagcgtgcgccacatcgccattcccgcgcaccgc
ggcctgatcactgaccgcaatggcgagccgctggccgtcagtacgccggttgccacgctg
tgggcgaatcccaaggaactggtgctcgaacgcgagaagtggggcttcctcgccgatgcc
ctcggccagtccagggccgctctgtcggaacgcctggaggcgaacgccgacaaggagttc
atctatttggtgcgtggcctgaccccggagcagggcgagggcgtgatggcccaggtgaaa
acccaccgcatccccggcgtctattcggtcgaggaattccgtcgcttctacccgtccggc
gaggttgccgcacaggtggtgggcttcactgacgtcgacgatcgtggtcgtgaaggcgtt
gaactggccttcgacagctggctggccggcgtgccgggcaagcgccaggtgctcaaggac
cgccgtggtcaccttatccgcgacgtgcaggtcacccgtaacgccaaggccggcaagacc
ctggccctgtccatcgacctgcgcctgcagtacctcgccaaccgcgagctgcgcaacgcg
ctggtggaaaacggcgccaaggccggcagcctggtgatcctcgacgtgaagactggcgaa
gtgctggccatgtccaaccagccgacctacaacccgaacaaccgtcgcaacctgcagccg
gcgatgatgcgcaaccgcgccatgatcgacgttttcgagcccggttcgaccatgaagccg
ttctccatgagcgcggcactggaaaccggccgctggaagccgaccgacaaggtcgaggtc
taccccggcaccctgcagatcggccgttacaccattcgcgacgtctcccgcagcgaaggt
ccggtgctggacctcaccggcatcctcatccgctccagtaacgtcggcatgagcaaggtc
gccttcgatatcggcggcgaagccatctacaacctgatgcagaaggtcggtctcggccag
gacaccggcctgggcttccccggcgagcgcgtcggcaacctgccgaactaccgcgagtgg
cgcaaggccgaaaccgcgaccctgtcctacggttacggtctgtcggtgaccgccatccaa
ctggctcacgcttactcggcgctggccaacaacggccgcagcgtgccgttgacgatggtc
cgcgccgaccgtcagccggactcgacccaggtcatccccgagcccgttgccaagaccatg
cagggcatgctccagcaggtggtcgaggcgcccaacggcgtattccgcgcccaggtgccg
ggctaccacgtggccggcaagtccggtaccgcgcgcaagaccgcaaccggcaccaagggt
tatgccgagaactcctaccgctccctgttcgccggcttcggcccgatgagcaatccgcgc
tacgtgatcgtggtcgtcatcgatgaacccagcaaggccggctactacggtggcctggtg
tccgcgccggtgttcagcaaggtgatgtccggcacgctgcgcctgatgaacgtaccgccg
gacaatctgccggcgactccgcagcagcaagccgatgctgcgcccgccaaaggagggcgt
ggctga

DBGET integrated database retrieval system