KEGG   Pseudomonas sp. ATCC 13867: H681_05720
Entry
H681_05720        CDS       T02524                                 
Name
(GenBank) putative permease
  KO
K08218  MFS transporter, PAT family, beta-lactamase induction signal transducer AmpG
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    H681_05720
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pdr02000]
    H681_05720
Transporters [BR:pdr02000]
 Major facilitator superfamily (MFS)
  Protein transporters
   Peptide-acetyl-CoA transporter (PAT) [TC:2.A.1.25]
    H681_05720
SSDB
Motif
Pfam: MFS_1 Acatn
Other DBs
NCBI-ProteinID: AGI23024
UniProt: M4WTD7
LinkDB
Position
complement(1252946..1254751)
AA seq 601 aa
MKEHSWREAWIAYKSPASLALLLLGFAAGLPYMLVLSTLSVWLREAGVARETIGFASWIG
LVYAFKWVWSPMLDQWRLPIIGRLGRRRSWLVFSQGLIALGLLGMALCNPQTHLNWLIAL
AMVVAFASATQDIAIDAYRLEIAENTRQAALAACYMTGYRVAVLTATAGVLFLAEWGGSS
ALHYSQGAWGMTYTVCALLILPGLITTLLMSEPPVNVQPQAGSSAFAFNHQLFSVLQLLV
LLISIPAMLTALTNQAWPRAALYAIFIGICMTPHGRRQIRPVRELLSKVRRPLLLAVHGK
GLPQFDFVHQAVSVMVLIILLVTGTAFYNMVSDGKYWLASLYLLVALSCISAPGRLLMAP
VLTPITEFVRRYRWQALLLLGLISTYRMSDTVMGTMASVFYIDMGFTKDTIATVSKLFGV
IMTLIGAAAGGVLIARFSILPILFIGGAASAATNILFAMLAQMGAIDDPHLMSQNVFSLL
KVLEPHVTMLVLTIMLDNFSGGLATSAFVAYLSSLTNLKFSATQYAMLSSTMLLLPRFIG
GYSGAMVEGMGYERFFFFTALLGLPTLVLIGWLWLRNRGDMTNGAPDEPSEAQAHPSAER
H
NT seq 1806 nt   +upstreamnt  +downstreamnt
atgaaagagcattcctggcgagaggcatggattgcctacaagtctcccgccagcctcgcg
cttttgctgctgggattcgccgccggcctgccgtacatgctggtgctctccaccctctcg
gtgtggttgcgtgaagcgggtgtcgctcgggaaaccatcggcttcgccagttggatcgga
ctggtctacgccttcaaatgggtgtggtcgccgatgctcgaccagtggcgcctgcccatc
atcggccgactcggacgccgccgctcctggctggtgttctcccagggcctgatcgccctg
ggcctgctcggcatggccctgtgcaatccgcaaacgcacctgaactggctgatcgccctg
gcgatggtggtggcgttcgcctccgccacccaggacatcgccatcgacgcctatcgcctg
gagatcgccgagaatacccgccaggccgccctcgccgcctgctacatgaccggctaccgg
gtcgccgtgctgacggccaccgccggcgtgctgttcctcgccgaatggggcggctccagc
gccctgcactacagccagggcgcctggggcatgacctatacggtgtgtgccctgctgatc
ctgcccggcctgatcaccaccctgctgatgagcgagcctccggtgaacgtgcagccacag
gccggcagctcggccttcgccttcaaccaccagttgttctcggtgctgcagttgctggtg
ctgctgatctccataccggcgatgctcaccgcgctgaccaaccaggcctggccgcgtgcc
gcgctctacgccatcttcatcggcatctgcatgaccccgcacggacgccggcagatccgt
ccggtgcgcgaattgctgtcgaaagtacgccgcccgctgctgctcgccgtgcacggcaag
ggcctgccgcaattcgatttcgtccaccaggccgtgtcggtgatggtgctgatcatcctg
ctggtgaccggcaccgccttctacaacatggtcagcgacggcaagtactggctcgcctcg
ctctacctgctggtcgccctgagctgcatctccgcgccgggccgcctgctgatggcgccg
gtgctcacgccgatcaccgagttcgtccgccgctaccgctggcaggcgctgctgctgctc
ggcctgatctccacctaccggatgtcggacaccgtcatgggcacgatggccagcgtgttc
tacatcgacatgggcttcaccaaggacaccatcgccaccgtcagcaagctgttcggtgtc
atcatgacgttgatcggcgccgccgccggcggggtgctgatcgcccgcttcagcatcctg
ccgatcctgttcatcggcggcgcggcctccgcggcgaccaacatcctgttcgccatgctg
gcgcagatgggagcgatcgacgatccgcacctcatgagccagaacgtcttcagcctgctg
aaggttctcgagccgcacgtcaccatgctggtgctgacgatcatgctcgacaacttcagc
ggcggcctggccacctcggccttcgtcgcctacctgtcgagcctgaccaacctgaagttc
tccgcgacccagtacgccatgctcagttccaccatgctgctgctgccgcgcttcattggc
ggttactccggagcgatggtcgaaggcatgggctacgaacggttcttcttcttcaccgcc
ctgctgggcctgccgaccctggtgctgatcggctggctctggctgcgcaaccgtggcgac
atgaccaacggcgcgccggacgagccgtccgaagcccaggcacatcccagcgcggaacgt
cactga

DBGET integrated database retrieval system