KEGG   Pseudomonas sp. ATCC 13867: H681_06145
Entry
H681_06145        CDS       T02524                                 
Name
(GenBank) basic amino acid/basic peptide/imipenem outer membrane porin OprD
  KO
K18093  imipenem/basic amino acid-specific outer membrane pore [EC:3.4.21.-]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr01501  beta-Lactam resistance
pdr02020  Two-component system
Module
pdr_M00745  Imipenem resistance, repression of porin OprD
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    H681_06145
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    H681_06145
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pdr02000]
    H681_06145
   01504 Antimicrobial resistance genes [BR:pdr01504]
    H681_06145
Enzymes [BR:pdr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-
     H681_06145
Transporters [BR:pdr02000]
 Other transporters
  Pores ion channels [TC:1]
   H681_06145
Antimicrobial resistance genes [BR:pdr01504]
 Gene sets
  beta-Lactam resistance modules
   Imipenem resistance, repression of porin OprD [MD:M00745]
    H681_06145
SSDB
Motif
Pfam: OprD
Other DBs
NCBI-ProteinID: AGI23109
UniProt: M4WTL9
LinkDB
Position
complement(1346007..1347335)
AA seq 442 aa
MKHLKRSAIVLAVSAAASQFASAEPFVTDQADAKGFVDDAKFDVLLRNYYYDHDGKNHTA
DNRDWTQGFLANFSSGYTQGTVGFGVDAFGYLGIKLDAGGGRTGTGNLPVDNHGKPEDDY
GKAGGALKVRISKTELKFGDMQPVAPVFAAGGSRLIPQTASGFNLLSSEIEGLDLEAGHF
TAGTSPITTSHDGGLYATYADVEADSVDYVGGLYAITDNLNVSLYGSEFEDIWRQYYANV
NYLQPLGGDQSLGLDFNIYRTNDYGQAKAGEISNTTWSLAAAYAFLQAHTVTLAFQKVHG
DTPFDYVGFGDNGSGAGGDSIFLANSVQFSDFNGPGERSWQARYDLAMDTYGVPGLSFMA
RYINGDNIDGTHADPNGRYVGMYGEDGKHHETDFEAKYVVQSGPVKDMSFRLRQAFHRSN
TDQGESDNNELRLIVDYPLSIL
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgaagcacctcaaacgcagcgccatcgtgcttgccgtttccgccgccgccagccagttc
gccagcgccgaacccttcgtcaccgaccaggccgatgccaagggcttcgtcgacgatgcc
aagttcgacgtgctgctgcgcaactactactacgaccacgacggcaagaatcacaccgcc
gataaccgcgactggacccagggcttcctcgccaacttctcctccggctacacccagggc
accgtcggtttcggcgtggacgccttcggctacctgggcatcaagctcgacgccggcggc
ggccgtaccggcaccggcaacctgccggtggacaaccacggcaagcccgaggacgactac
ggcaaggccggtggcgcgctgaaggtgcgtatttccaagaccgagctgaaattcggcgac
atgcagccggtcgcaccggtgttcgccgccggcggcagccgcctgattccacaaaccgcg
tcgggcttcaacctgctgagcagcgaaatcgagggcctggacctggaagccggccacttc
accgctggtaccagcccgatcaccaccagccacgacggcggcctgtacgcgacctacgcg
gacgtcgaagccgacagcgtcgactatgtcggcggcctgtacgcgatcaccgacaacctg
aacgtctcgctgtacggttccgagttcgaggacatctggcgccagtactacgccaacgtg
aactacctgcagccgctgggcggcgaccagtcgctgggcctggatttcaacatctaccgc
accaatgactacggccaggccaaggccggcgagatcagcaacaccacctggtcgctggca
gccgcgtacgccttcctgcaggcgcacaccgtcaccctggccttccagaaggtccacggc
gacaccccgttcgactacgtgggcttcggcgacaacggctcgggcgccggcggcgactcg
atcttcctcgccaactccgtgcagttctccgacttcaacggcccgggcgaacgctcctgg
caggcacgctacgacctggcgatggacacctacggcgtacccggcctgagcttcatggcc
cgctacatcaacggcgacaacatcgacggcacccacgccgacccgaacggccggtacgtc
ggcatgtacggtgaagacggcaagcaccacgaaaccgacttcgaagccaagtacgtcgtg
cagtccggcccggtgaaggacatgtccttccgcctgcgccaggccttccaccgctccaat
accgatcagggcgagtccgacaacaacgaactgcgtctgatcgtcgattatccgctgtcg
atcctgtaa

KEGG   Pseudomonas sp. ATCC 13867: H681_17855
Entry
H681_17855        CDS       T02524                                 
Name
(GenBank) basic amino acid/basic peptide/imipenem outer membrane porin OprD
  KO
K18093  imipenem/basic amino acid-specific outer membrane pore [EC:3.4.21.-]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr01501  beta-Lactam resistance
pdr02020  Two-component system
Module
pdr_M00745  Imipenem resistance, repression of porin OprD
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    H681_17855
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    H681_17855
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pdr02000]
    H681_17855
   01504 Antimicrobial resistance genes [BR:pdr01504]
    H681_17855
Enzymes [BR:pdr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-
     H681_17855
Transporters [BR:pdr02000]
 Other transporters
  Pores ion channels [TC:1]
   H681_17855
Antimicrobial resistance genes [BR:pdr01504]
 Gene sets
  beta-Lactam resistance modules
   Imipenem resistance, repression of porin OprD [MD:M00745]
    H681_17855
SSDB
Motif
Pfam: OprD Attacin_N
Other DBs
NCBI-ProteinID: AGI25438
UniProt: M4WZ65
LinkDB
Position
4019320..4020633
AA seq 437 aa
MKVMKWSAIALAVSAGTTQLAMAEPFVGNQAESKGFVEDSSLNFLVRNYYFNRSNTGGAT
DARDWSQGFLANYNSGFTQGTVGFGVDAFGYLGLKLDGGSGYGKTGNLPLHDDGDKADDY
GKAGAALKVRISKTELKIGDMQPTAPVFAVGGTRLLPQTASGIALMSSEIEGLDLEGGHY
YSGTNYDTTNRDGEIWAQYGGETADSADFVGGRYQFNDQFSASLYGAQVEDLWDQYYANL
NYTLPIADNQSLGFDFNYYNTRDSGDAKLGDISNNTFSLAAAYTISAHTFTLAYQDVNGD
TPFDYIGIGDNNGGGDSIFLANSIQYSDFNGPGEKSWQGRYDLDMTEYGVPGLSFMTRYI
SGKDIDGSHADGTAYEGAYGNDDSERETNVEAKYVLQSGPAKDLSFRIRQAWHRGDDSTG
GKVDEFRLIVDYPLSVL
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgaaagtgatgaagtggagcgccatcgccctggcggtttctgcaggcaccacgcaactg
gcaatggccgagcccttcgtaggcaatcaggctgaatccaagggctttgtcgaagacagc
agcctgaacttcctggttcgcaactactacttcaaccgtagcaataccggtggcgctacc
gacgcccgcgactggagccaaggcttcctggccaactacaactccggtttcactcaaggc
accgtcggcttcggcgtcgatgccttcggctacctcggtttgaaacttgacggcggcagc
ggctacggcaagaccggcaacctgccactccacgacgacggcgacaaggctgacgactac
ggcaaggctggggcagccctcaaggtccgtatctccaagaccgaactgaaaatcggcgac
atgcagcccaccgctccggtattcgccgtaggcggcacccgcctgctgccgcagactgcc
agcggtatcgccctgatgagcagcgaaatcgaaggcctggatctggaaggcggtcactac
tactccggcaccaactatgacaccaccaaccgcgacggcgagatctgggcgcaatatggt
ggcgagactgccgattccgccgacttcgtaggcggcagataccagttcaacgatcagttc
agcgcatcgctgtacggcgcccaggtcgaagatctctgggaccagtactacgccaacctg
aactacaccctgccgatcgcagacaaccaatcgctgggcttcgacttcaactactacaac
acccgcgattcgggtgatgccaagctgggtgacatcagcaacaacaccttctcgctggct
gccgcctacaccatcagcgcgcacaccttcaccctggcctaccaggacgtcaacggcgat
actccgttcgactacatcggtatcggtgacaacaacggtggcggcgactcgatcttcctc
gccaactcgattcaatactccgacttcaacggcccgggcgaaaaatcctggcaaggccgt
tacgacctggacatgactgagtacggtgttcccggcctgagcttcatgactcgttacatc
agcggtaaggatatcgacggctcccacgctgacggcactgcctacgaaggcgcctacggc
aatgacgacagcgagcgcgagaccaacgtcgaggccaagtacgtactgcagagcggcccg
gccaaggacctgtccttccgtatccgccaagcctggcaccgtggcgacgacagcaccggt
ggcaaggtcgacgagttccgcctgatcgtcgactacccgctgtccgtcctgtaa

DBGET integrated database retrieval system