KEGG   Pseudomonas sp. ATCC 13867: H681_07660
Entry
H681_07660        CDS       T02524                                 
Symbol
eno
Name
(GenBank) enolase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00010  Glycolysis / Gluconeogenesis
pdr00680  Methane metabolism
pdr01100  Metabolic pathways
pdr01110  Biosynthesis of secondary metabolites
pdr01120  Microbial metabolism in diverse environments
pdr01200  Carbon metabolism
pdr01230  Biosynthesis of amino acids
pdr03018  RNA degradation
Module
pdr_M00002  Glycolysis, core module involving three-carbon compounds
pdr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H681_07660 (eno)
  09102 Energy metabolism
   00680 Methane metabolism
    H681_07660 (eno)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    H681_07660 (eno)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdr03019]
    H681_07660 (eno)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdr04147]
    H681_07660 (eno)
Enzymes [BR:pdr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     H681_07660 (eno)
Messenger RNA biogenesis [BR:pdr03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     H681_07660 (eno)
Exosome [BR:pdr04147]
 Exosomal proteins
  Proteins found in most exosomes
   H681_07660 (eno)
SSDB
Motif
Pfam: Enolase_C Enolase_N MAAL_C MR_MLE_C
Other DBs
NCBI-ProteinID: AGI23408
UniProt: M4WTG8
LinkDB
Position
1670946..1672235
AA seq 429 aa
MAKIVDIKGREVLDSRGNPTVEADVILDNGIVGSACAPSGASTGSREALELRDGDKSRYL
GKGVLKAVANINGPIRDLLLGKDAADQKGLDHAMIDLDGTENKGKLGANAILAVSLAAAK
AAAQAKGVPLYAHIADLNGTPGQYSMPVPMMNIINGGEHADNNVDIQEFMVQPVGAKNFA
DALRMGAEIFHHLKAVLKARGLNTAVGDEGGFAPNLASNEDALAAIAEAVANAGYKLGDD
VTLALDCASSEFFKDGQYDLEGEGKVFSAEGFADYLAGLTQRYPIISIEDGMDESDWAGW
KVLTDKIGEKVQLVGDDLFVTNTKILKRGIDEKIGNSILIKFNQIGSLTETLEAIQMAKA
AGFTAVISHRSGETEDSTIADLAVGTAAGQIKTGSLCRSDRVSKYNQLLRIEEQLGAKAP
YRGRAEFRG
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggcaaagatcgtcgacatcaagggccgtgaggtcctggactcccgcggcaacccgacc
gttgaagcggacgtgatcctggacaacggcatcgtcggcagcgcttgcgccccgtccggt
gcatccaccggttctcgcgaggctctcgaactgcgcgatggcgacaagagccgttacctg
ggcaagggcgtgctgaaagccgtggccaacatcaatggcccgatccgcgacctgctgctg
ggcaaggacgcggctgaccagaaaggtctggatcacgcgatgatcgacctcgacggcacc
gagaacaagggcaagctgggcgccaacgccatcctggccgtctccctggccgccgccaag
gccgctgcccaggccaagggcgtaccgctgtacgcgcacatcgccgacctgaacggcacc
ccgggccagtactccatgccggttccgatgatgaacatcatcaacggcggcgagcacgcc
gataacaatgtcgacatccaggagttcatggtccagccggttggcgccaagaacttcgcc
gacgcgctgcgcatgggcgccgagatcttccaccacctcaaagccgtgctgaaggcccgt
ggcctgaacaccgccgtgggcgacgaaggcggcttcgcgccgaacctggcttccaacgaa
gacgccctggcggccatcgccgaagccgtcgccaacgccggctacaagctgggcgatgac
gtgaccctggccctggactgcgcctcctccgagttcttcaaggacggtcagtacgacctg
gaaggcgaaggcaaggtattcagcgccgaaggtttcgccgactacctggccggtctgacc
cagcgctacccgatcatctccatcgaagacggcatggacgagtccgactgggctggctgg
aaagtcctgaccgacaagatcggcgagaaggtacagctggtcggtgacgacctgttcgtg
accaataccaagatcctcaaacgcggcatcgacgagaagatcggcaactcgatcctgatc
aagttcaaccagatcggctcgctgaccgagaccctggaagccatccagatggccaaggcc
gccggcttcaccgcggtgatctcgcaccgttcgggcgaaaccgaggacagcaccatcgct
gacctggctgtcggcactgccgctggtcagatcaagaccggttccctctgccgctccgac
cgcgtttccaagtacaaccagctgctgcgtatcgaagagcagctgggcgccaaggcgccg
taccgtggtcgtgcggaattccgcggctga

DBGET integrated database retrieval system