KEGG   Pseudomonas sp. ATCC 13867: H681_14430
Entry
H681_14430        CDS       T02524                                 
Symbol
ampC
Name
(GenBank) beta-lactamase/D-alanine carboxypeptidase
  KO
K01467  beta-lactamase class C [EC:3.5.2.6]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr01501  beta-Lactam resistance
pdr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    H681_14430 (ampC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    H681_14430 (ampC)
Enzymes [BR:pdr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.6  beta-lactamase
     H681_14430 (ampC)
SSDB
Motif
Pfam: Beta-lactamase
Other DBs
NCBI-ProteinID: AGI24756
UniProt: M4WZR2
LinkDB
Position
3255025..3256170
AA seq 381 aa
MRLTGPLALSCSLTLACIPPANAVAPDFDAKVQRAAEAVMREHAIAGLAIGVTDNGEQRF
YNFGLASKESRQPVTSDTLFEVGSISKTFTVTLAAFAQAAGKLSLKASPTRYMPELRGSA
LDKVSLINLATHTAGGFPLQIPEAVQTSAQLTEYYNDWQPQYLAGTQRTYANPSIALVGF
ATERALDVPFKTAMQRNVFAPLGLSNTHIEVPVTRQGYYAQGYDKNDAPVRLNPDVLADV
AYGVRSSSRDLLHFVEIQLGRVKPGEKLQAALDATRTGYYKVGPMTQDLIWEQYAYPPKL
AELQQYNGSQMIQGNQVVTALTPPLPPQQKVWVNKTGATAGFGAYVAFVPAKQRGIVLLA
NRNYPNEARVKLAWDILSWLE
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgcgcctgaccggcccgctcgcactcagctgctcgctcaccctcgcctgcattcccccg
gccaacgccgtggcgccggacttcgatgccaaggtgcagagggccgccgaggcagtgatg
cgcgaacacgctatcgcggggctggcgatcggcgtcaccgacaacggcgagcagcgcttc
tacaacttcggcctggcgtcgaaggaaagccgccagccggtcaccagcgataccctgttc
gaggtcggctcgatcagcaagaccttcaccgtgaccctcgccgccttcgcccaggccgcc
ggcaagctgtcgctgaaggcgagccccacccgctatatgccggagctgcgcggcagcgcg
ctggacaaggtcagcctgatcaacctcgccacccataccgccggcggcttcccgttgcag
attcccgaggcggtgcaaacgtccgcgcagctcaccgagtactacaacgactggcagccg
cagtacctcgccggcacccagcgcacctacgccaacccgagcatcgccctggtcggcttc
gccaccgagcgggcactcgacgtgccgttcaagacggcgatgcagcgcaacgtgttcgcc
ccgctgggcctctccaacacccatatcgaggtgccggtgacccgccagggctactacgcc
cagggctacgacaagaacgacgcgccggtgcggctcaaccccgacgtgctggccgacgtg
gcctacggcgtacgcagcagcagccgcgacctgctgcacttcgtcgagatccagctgggc
cgggtcaagccgggggagaagctgcaggccgcgctcgacgccacccgcaccggctactac
aaggtcggcccgatgacccaggacctgatctgggagcagtacgcctacccgccgaagctg
gccgagctgcagcagtacaacggcagccagatgatccagggcaaccaggtggtcaccgcc
ctcaccccaccgttgccgccgcagcagaaggtctgggtgaacaagaccggcgccaccgca
ggcttcggcgcctacgtggcgttcgtgccggcgaaacagcgcggcatcgtgctgctcgcc
aaccgcaactatcccaacgaggcgcgggtgaagctggcctgggacattctttcatggttg
gagtga

DBGET integrated database retrieval system