KEGG   Pseudomonas sp. ATCC 13867: H681_15645
Entry
H681_15645        CDS       T02524                                 
Name
(GenBank) ATP-dependent RNA helicase
  KO
K05592  ATP-dependent RNA helicase DeaD [EC:3.6.4.13]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    H681_15645
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdr03019]
    H681_15645
   03009 Ribosome biogenesis [BR:pdr03009]
    H681_15645
Enzymes [BR:pdr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     H681_15645
Messenger RNA biogenesis [BR:pdr03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     H681_15645
Ribosome biogenesis [BR:pdr03009]
 Prokaryotic type
  rRNA helicases
   H681_15645
SSDB
Motif
Pfam: DEAD Helicase_C DbpA ResIII DprA_WH
Other DBs
NCBI-ProteinID: AGI24997
UniProt: M4X1T5
LinkDB
Position
complement(3539392..3541080)
AA seq 562 aa
MTQETGGFAALGIHPNILAAIAAVGYEEPSPIQAQSIPVILEGHDMIGQAQTGTGKTAAF
ALPLLSKIEPSRRVPQVLVLVPTRELALQVATACETYSKQMPGVGVVAVYGGAPMGPQLK
ALRQGAQVLVATPGRLCDHLRRDENLLSTVERLVLDEADEMLKLGFMDDLEVIFEAMPAS
RQTVLFSATLPASIRSIAERHLKEPKHVRIAAKTQTVARIEQVHLMVHADQKPASILRLL
EVEQFDALIGFVRTKQATLDIAELLERQGYRAAALNGDMPQAQRERVIESLKDGSLDIVI
ATDVAARGLDVARITHVLNVDMPYDPESYVHRIGRTGRAGREGRALLLVTPRERRMLQVI
ERVTGQKVGEVRLPDADTVLEARLNRLATGLQPLLANAVASRGAVRDELCRRLGTDMDTL
AAVLLAKLTEGKALDLESVRREQPLTPAAPRERSDRYERGDRAERGDRPERSGERRPMAP
PSEGKSRCRTALGARDGVQAKNLLGAILNEGGLSREAIGRIQIRETFSLIELPDENLDRL
LTKLKDTRVAGKALRLRRYRED
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgacccaggaaaccggcggcttcgccgcgctcggcattcatcccaatatcctcgcggcc
atcgccgccgtcggctatgaagagccgtccccgatccaggcccagtcgatcccggtgatc
ctcgaaggccacgacatgatcggccaggcccagaccggtaccggcaagaccgccgccttc
gcgctgccgctgctgtcgaagatcgaaccgagccgccgcgttccgcaggtgctggtactg
gtaccgactcgcgagctggccctgcaggtcgctaccgcgtgcgaaacctactccaagcag
atgccgggcgttggcgtcgttgccgtctacggtggcgcgccgatgggcccgcagctcaag
gccctgcgccagggcgcccaggtcctggtggccactccgggccgcctgtgcgaccacctg
cgtcgcgacgagaacctgctctccaccgtcgagcgcctggtcctcgacgaagcggacgaa
atgctcaagctcggcttcatggatgacctcgaagtgatcttcgaggccatgccggccagc
cgccagaccgtactgttctccgcgaccctgccggcttcgatccgcagcatcgccgaacgt
cacctgaaagagcccaagcacgtccgcatcgccgccaagacccagaccgtcgcccgcatc
gagcaggtgcacctgatggtccacgccgaccagaagccggcctcgatcctgcgtctgctg
gaagtcgagcagttcgacgcgctgatcggcttcgtccgtaccaaacaggccaccctggac
atcgccgagctgctcgagcgccagggctaccgtgccgccgcgctgaacggcgacatgccg
caggcccagcgtgagcgcgtgatcgagtcgctgaaggacggctcgctggacatcgtcatc
gccaccgacgttgccgcccgtggcctcgacgtggcgcgcatcacccacgtactgaacgtg
gacatgccgtacgacccggaatcctacgtacaccgcatcggccgtaccggccgtgccggt
cgtgaaggtcgtgcgctgctgctggtgaccccgcgcgagcgccgcatgctgcaggtgatc
gagcgtgtgaccggtcagaaggtcggcgaagttcgcctgccggacgccgacaccgtcctt
gaagcccgtctgaaccgcctggccaccggcctgcagccgctgctggccaacgctgttgcc
agccgtggcgccgtgcgtgacgagctgtgccgccgcctgggtaccgacatggacaccctg
gctgccgtgctgctggccaagctgaccgaaggcaaggcgctggacctggaatcggtccgc
cgcgagcaacctctgactccggccgccccgcgtgagcgcagcgaccgttacgagcgtggc
gatcgcgccgagcgcggtgaccgtccggaacgcagcggcgagcgtcgcccgatggcgccg
ccgtcggagggcaagtcccgctgccgtaccgccctgggcgcccgcgatggcgtgcaggcg
aagaacctgctgggcgccatcctcaacgagggcggcctgtcccgcgaggccatcggccgc
atccagatccgcgagaccttcagcctgatcgagctgccggacgagaacctcgaccgtctg
ctgaccaagctcaaggacacccgcgtcgccggcaaggccctgcgcctgcgccgttaccgc
gaagactga

DBGET integrated database retrieval system