KEGG   Pseudomonas sp. ATCC 13867: H681_15645
Entry
H681_15645        CDS       T02524                                 
Name
(GenBank) ATP-dependent RNA helicase
  KO
K05592  ATP-dependent RNA helicase DeaD [EC:3.6.4.13]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    H681_15645
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdr03019]
    H681_15645
   03009 Ribosome biogenesis [BR:pdr03009]
    H681_15645
Enzymes [BR:pdr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     H681_15645
Messenger RNA biogenesis [BR:pdr03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     H681_15645
Ribosome biogenesis [BR:pdr03009]
 Prokaryotic type
  rRNA helicases
   H681_15645
SSDB
Motif
Pfam: DEAD Helicase_C DbpA ResIII DprA_WH
Other DBs
NCBI-ProteinID: AGI24997
UniProt: M4X1T5
LinkDB
Position
complement(3539392..3541080)
AA seq 562 aa
MTQETGGFAALGIHPNILAAIAAVGYEEPSPIQAQSIPVILEGHDMIGQAQTGTGKTAAF
ALPLLSKIEPSRRVPQVLVLVPTRELALQVATACETYSKQMPGVGVVAVYGGAPMGPQLK
ALRQGAQVLVATPGRLCDHLRRDENLLSTVERLVLDEADEMLKLGFMDDLEVIFEAMPAS
RQTVLFSATLPASIRSIAERHLKEPKHVRIAAKTQTVARIEQVHLMVHADQKPASILRLL
EVEQFDALIGFVRTKQATLDIAELLERQGYRAAALNGDMPQAQRERVIESLKDGSLDIVI
ATDVAARGLDVARITHVLNVDMPYDPESYVHRIGRTGRAGREGRALLLVTPRERRMLQVI
ERVTGQKVGEVRLPDADTVLEARLNRLATGLQPLLANAVASRGAVRDELCRRLGTDMDTL
AAVLLAKLTEGKALDLESVRREQPLTPAAPRERSDRYERGDRAERGDRPERSGERRPMAP
PSEGKSRCRTALGARDGVQAKNLLGAILNEGGLSREAIGRIQIRETFSLIELPDENLDRL
LTKLKDTRVAGKALRLRRYRED
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgacccaggaaaccggcggcttcgccgcgctcggcattcatcccaatatcctcgcggcc
atcgccgccgtcggctatgaagagccgtccccgatccaggcccagtcgatcccggtgatc
ctcgaaggccacgacatgatcggccaggcccagaccggtaccggcaagaccgccgccttc
gcgctgccgctgctgtcgaagatcgaaccgagccgccgcgttccgcaggtgctggtactg
gtaccgactcgcgagctggccctgcaggtcgctaccgcgtgcgaaacctactccaagcag
atgccgggcgttggcgtcgttgccgtctacggtggcgcgccgatgggcccgcagctcaag
gccctgcgccagggcgcccaggtcctggtggccactccgggccgcctgtgcgaccacctg
cgtcgcgacgagaacctgctctccaccgtcgagcgcctggtcctcgacgaagcggacgaa
atgctcaagctcggcttcatggatgacctcgaagtgatcttcgaggccatgccggccagc
cgccagaccgtactgttctccgcgaccctgccggcttcgatccgcagcatcgccgaacgt
cacctgaaagagcccaagcacgtccgcatcgccgccaagacccagaccgtcgcccgcatc
gagcaggtgcacctgatggtccacgccgaccagaagccggcctcgatcctgcgtctgctg
gaagtcgagcagttcgacgcgctgatcggcttcgtccgtaccaaacaggccaccctggac
atcgccgagctgctcgagcgccagggctaccgtgccgccgcgctgaacggcgacatgccg
caggcccagcgtgagcgcgtgatcgagtcgctgaaggacggctcgctggacatcgtcatc
gccaccgacgttgccgcccgtggcctcgacgtggcgcgcatcacccacgtactgaacgtg
gacatgccgtacgacccggaatcctacgtacaccgcatcggccgtaccggccgtgccggt
cgtgaaggtcgtgcgctgctgctggtgaccccgcgcgagcgccgcatgctgcaggtgatc
gagcgtgtgaccggtcagaaggtcggcgaagttcgcctgccggacgccgacaccgtcctt
gaagcccgtctgaaccgcctggccaccggcctgcagccgctgctggccaacgctgttgcc
agccgtggcgccgtgcgtgacgagctgtgccgccgcctgggtaccgacatggacaccctg
gctgccgtgctgctggccaagctgaccgaaggcaaggcgctggacctggaatcggtccgc
cgcgagcaacctctgactccggccgccccgcgtgagcgcagcgaccgttacgagcgtggc
gatcgcgccgagcgcggtgaccgtccggaacgcagcggcgagcgtcgcccgatggcgccg
ccgtcggagggcaagtcccgctgccgtaccgccctgggcgcccgcgatggcgtgcaggcg
aagaacctgctgggcgccatcctcaacgagggcggcctgtcccgcgaggccatcggccgc
atccagatccgcgagaccttcagcctgatcgagctgccggacgagaacctcgaccgtctg
ctgaccaagctcaaggacacccgcgtcgccggcaaggccctgcgcctgcgccgttaccgc
gaagactga

KEGG   Pseudomonas sp. ATCC 13867: H681_17255
Entry
H681_17255        CDS       T02524                                 
Name
(GenBank) ATP-dependent DNA helicase RecQ
  KO
K03654  ATP-dependent DNA helicase RecQ [EC:5.6.2.4]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    H681_17255
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdr03019]
    H681_17255
   03400 DNA repair and recombination proteins [BR:pdr03400]
    H681_17255
Enzymes [BR:pdr01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     H681_17255
Messenger RNA biogenesis [BR:pdr03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     H681_17255
DNA repair and recombination proteins [BR:pdr03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      H681_17255
SSDB
Motif
Pfam: RQC HRDC RecQ_Zn_bind Helicase_C DEAD HTH_40 Sigma70_r4_2 HTH_38 HTH_23 HTH_29 HTH_7 GerE HTH_28 Transposase_mut HTH_20 PAX
Other DBs
NCBI-ProteinID: AGI25319
UniProt: M4WZS0
LinkDB
Position
complement(3896107..3898254)
AA seq 715 aa
MLDQAQRILKDVFGYDAFRGNQARIIERVAGGGDALVLMPTGGGKSLCFQVPALLREGLT
VVVSPLIALMEDQVATLDELGVPVAALNSSLSPEAQREIADRLQRGEIKLLYLAPERLVQ
PRMLAFLQRLEIGLFAIDEAHCVSQWGHDFRPEYLQLGQLAELFPHVPRIALTATADMRT
REEMIQRLHLQDAEQFLSSFDRPNIFYRIVPKEQPRKQLLGFLAERRGDAGIVYCMSRKK
VEEVAEFLSNQGFPALPYHAGLSNDLRAFHQKRFLNEEGLIMVATIAFGMGIDKPNVRFV
AHLDLPKSLEAYYQETGRAGRDGLPADAWMAYGLQDVLLLRQMMQNSEGDERHKRVERHK
LEAMLALCEETRCRRQALLAYFDEVMPDPCGHCDICVDGVETWDATEPARQALSAIYRSG
QRYGVGHLVDVLLGKDTEKVRSAGHQHLAVFGIGKSRAEDEWRTLFRQLVARGFADVDVD
GFNGLRLTEACRPLLRGEETLALRRDPKPQRSKSSSSTGGASPASQLVRQEEREMWEALR
TLRRKLAQEHSVPPYVIFPDATLLEMLRSQPTTLTAMAQVSGVGARKLERYGQAFLDVLT
ESEAAPDAPAPVTDLRHELVTLARAGMTPAQIARQLDCSEKNVYSLLAEAIGRQQLTLEQ
ALDLPEELLGEVQDAFLDEDGELPPVNAIAELFEGRVPLGVLHCVRAALQAELEV
NT seq 2148 nt   +upstreamnt  +downstreamnt
atgctcgatcaggcccagcgcatcctcaaagacgttttcggttacgacgccttccgcggc
aatcaggcgcggatcatcgagcgcgtggccggcggcggcgatgcgctggtgctgatgccc
accggcggcggcaagtcgctgtgcttccaggtcccggcgctgctgcgcgaggggctgacg
gtggtggtctcgccgctgatcgcactgatggaagaccaggtcgccacgctggacgaactg
ggcgtgccggtggcggcgctgaactcctcgctgagccccgaggcccagcgcgagatcgcc
gaccgcctgcagcgcggcgagatcaagctgctctatctggccccggaacgcctggtgcag
ccgcgcatgctggccttcctgcagcgcctggagatcggcctgttcgccatcgacgaagca
cactgcgtgtcgcaatggggccacgacttccgtcctgaatacctgcaactgggccagctc
gccgagctgttcccgcacgtgccgcgcatcgccctgaccgccacggcggacatgcgcacc
cgcgaggagatgatccagcgcctgcacctgcaggacgccgagcagttcctctccagcttc
gaccggccgaacatcttctaccgcatcgtgcccaaggagcagccgcgcaagcagttgctg
ggcttcctcgccgagcggcgcggcgacgcgggcatcgtctactgcatgtcgcgcaagaag
gtcgaggaggtcgccgagttcctctccaaccagggcttcccggcgctgccgtaccacgcc
gggctgtccaacgacctgcgcgccttccaccagaagcgcttcctcaacgaggaagggctg
atcatggtcgccaccatcgcctttggcatgggcatcgacaaacccaacgtgcgcttcgtc
gcgcacctggatctgcccaagagcctggaggcgtactaccaggaaaccggccgcgccggc
cgtgacggcctgcccgccgacgcctggatggcctacggcctgcaggacgtgttgctgctg
cggcagatgatgcagaactccgagggcgacgaacgccacaagcgcgtcgaacggcacaag
ctcgaagccatgctggcgctgtgcgaggaaacccgctgccgccgccaggcgctgctggcc
tacttcgacgaggtgatgcccgatccttgcggccactgcgatatctgcgtcgatggcgtg
gaaacctgggacgccaccgagccggcgcgccaggccctgtcggcgatctaccgcagcggc
cagcgctacggcgtcggccacctggtggacgtgctgctgggcaaggacaccgagaaggtc
cgcagtgccggccaccagcacctggcggtattcggcatcggcaagtcccgtgccgaggac
gaatggcgcacgctgttccgccaactggtcgcccgcggcttcgccgatgtggacgtcgac
ggcttcaacggcctgcgcctgaccgaggcctgccgtccgctgctgcgcggcgaagagacg
ctggccctgcgccgcgatcccaagccgcagcgcagcaagtcgtcgtcttccactggcggc
gccagcccggccagccaactggtacgccaggaagagcgcgagatgtgggaagccctgcgt
accctgcggcgcaagttggcccaggagcactcggtgccgccctacgtcatcttccccgat
gcgaccctgctggagatgctgcgcagccagcccaccacgctcaccgcgatggcccaggtc
agcggcgtcggcgcgcgcaagctggaacgctacggccaggccttcctcgacgtgctcacc
gagtccgaggcggcgcccgacgccccggcgccggtcaccgacctgcgccatgaactggtg
accctggcccgcgccggcatgaccccggcacagatcgcccgccagctcgattgcagcgag
aagaacgtctacagcctgctggccgaggccatcggccgtcagcaactgaccctggagcag
gcgctggacctgcccgaggaactgcttggcgaagtacaggacgccttcctcgacgaggac
ggcgagctgccgccggtgaatgccatcgccgagctgttcgaaggccgcgtgccgctggga
gtgctgcactgtgtgcgcgccgcgttgcaggccgagctggaagtctga

KEGG   Pseudomonas sp. ATCC 13867: H681_23430
Entry
H681_23430        CDS       T02524                                 
Name
(GenBank) ATP-dependent DNA helicase, RecQ-like protein
  KO
K03654  ATP-dependent DNA helicase RecQ [EC:5.6.2.4]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    H681_23430
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdr03019]
    H681_23430
   03400 DNA repair and recombination proteins [BR:pdr03400]
    H681_23430
Enzymes [BR:pdr01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     H681_23430
Messenger RNA biogenesis [BR:pdr03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     H681_23430
DNA repair and recombination proteins [BR:pdr03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      H681_23430
SSDB
Motif
Pfam: Helicase_C DEAD RecQ_Zn_bind ResIII
Other DBs
NCBI-ProteinID: AGI26553
UniProt: M4X2B4
LinkDB
Position
complement(5252399..5254336)
AA seq 645 aa
MHDTLERVFGFRQFRPGQEAAVSAVLAGRSAAAIFPTGSGKSLCYQLPALLLPHLTLVVS
PLLALMQDQLAFLARHGIAAASIDSAQSREQAAQTMARARSGELKVLMISVERLKNERFR
NFISEVPISLLVVDEAHCISEWGHNFRPDYLKLPDYQKQLRIPQVLLLTATATPAVIADM
RGKFAIAESDVVTTGFYRANLDLQVEPVASAARRARLVQWLGERAGQPAIVYVTQQKTAE
EVAAHLAERGIPACAYHAGMEHPEREGIQRRFMEGRLNCIVATIAFGMGIDKSDIRQVVH
YDLPKSLENYSQEIGRAGRDGQRSECLVLANRDSLNVLENFVYGDTPEREGIRFVLEEIR
QAAGYQGGGQWETMLVPLSDQSNIRQLPLKTLLVQLELRGIIAPRFAYFAEYRFKLLIDS
AELLGHFQGERRQFVDAILTTSARARTWATLDFDTLYNRHGAERARVVKALDYFQERGWV
ELESKQMTEVYSVRDASFSVDELSDELHRYFKRHEDSEIARIGAMLELLGSSECLSWRLA
QYFGDQQAPRRCGHCSVCAGRVARLPEPPALPPLEGQNLHNRCAAFLEKYRSARGLVPSA
DCVTRFLCGISVPAFTRMRARTLPGYAMLEDYPYARVRDWVQAQL
NT seq 1938 nt   +upstreamnt  +downstreamnt
atgcacgacaccctcgaacgcgtcttcggcttccgccagttccgccccggccaggaggca
gcggtcagtgcggtgctggccgggcgctcggcggcggcgatcttccccacgggctcgggc
aagtcgctgtgctaccaactgccggcattgctgctgccgcacctgaccctggtggtctcg
cccttgctggcgctgatgcaggaccagctcgccttcctcgcccgccacggcatcgccgcc
gccagcatcgactcggcgcagagccgcgagcaggcggcgcagacgatggcgcgggcacgc
agcggcgagctgaaggtattgatgatctcggtggagcgcctgaagaacgagcgtttccgc
aatttcatcagcgaggtgccgatctccctgctggtggtggacgaggcgcactgcatttcc
gaatggggccacaacttccgtcccgactacctgaagctgccggactaccagaagcagttg
cgcattccccaggtactgctgctcaccgccacggcgacgccagcggtgattgccgacatg
cgcggcaagttcgccatcgccgagtccgacgtggtcaccaccggcttctaccgcgccaac
ctcgacctgcaggtggagccggtggccagcgccgcccgccgcgcgcggctggtgcagtgg
ctgggcgagcgcgccgggcagccggccatcgtctacgtcacccagcagaagaccgccgag
gaagtcgccgcgcacttggccgagcgcggcattcccgcttgcgcctaccacgccggcatg
gaacacccggagcgcgagggcatccagcgccgcttcatggaggggcggctgaactgcatc
gtcgccaccatcgccttcggcatgggtatcgacaagagcgacatccgccaggtggtgcac
tacgacctgcccaagtcgctggagaactacagccaggagatcggccgtgccgggcgcgac
ggccagcgctcggaatgcctggtgctggccaaccgcgacagcctcaacgtgctggagaac
ttcgtctacggcgacacgcccgagcgcgaaggcattcgcttcgtgctggaggaaatccgc
caggctgctggctatcagggaggtggccagtgggagaccatgctggtgccgctgtcggac
cagtccaacatccgccagctgccattgaagacactgctggttcagctggagttacgcggc
attatcgctccacgattcgcctatttcgccgaatatcgcttcaagctgctgatcgattcc
gctgagctgctagggcatttccagggcgagcggcgccagttcgtcgatgccatcctcacc
acctcggcgcgggccaggacctgggcgaccctggatttcgacaccctctacaaccgtcac
ggcgccgagcgcgcgcgggtggtgaaggcgctggactacttccaggagcgcggctgggtg
gagctggaaagcaagcagatgaccgaggtctactcggtgcgcgatgcgtccttctctgtg
gatgagttgagcgacgagctgcatcgctacttcaagcgccacgaggacagcgaaatcgcc
cgtatcggcgccatgctcgaactgctgggcagttcggagtgcctgagctggcggctggcg
cagtacttcggcgaccagcaggctccccgccgttgcgggcactgctcggtctgcgccggc
cgcgtcgcccgcctgccggagccgcccgcgctgccgccactggaagggcagaacctgcac
aaccgctgtgccgccttcctggagaagtaccgcagcgcccgtggcctggtacccagcgcc
gactgcgtgacgcgtttcctctgcggtatcagcgtgccggctttcacccgcatgcgcgca
cgcacgctgcccggctacgcgatgctggaggactacccctacgccagggtgcgcgattgg
gtacaggctcagttgtaa

DBGET integrated database retrieval system