KEGG   Pseudomonas sp. ATCC 13867: H681_16090
Entry
H681_16090        CDS       T02524                                 
Name
(GenBank) ribonuclease E
  KO
K08300  ribonuclease E [EC:3.1.26.12]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    H681_16090
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdr03019]
    H681_16090
   03009 Ribosome biogenesis [BR:pdr03009]
    H681_16090
Enzymes [BR:pdr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.12  ribonuclease E
     H681_16090
Messenger RNA biogenesis [BR:pdr03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     H681_16090
Ribosome biogenesis [BR:pdr03009]
 Prokaryotic type
  rRNA processing factors
   H681_16090
SSDB
Motif
Pfam: RNase_E_G S1
Other DBs
NCBI-ProteinID: AGI25086
UniProt: M4X0M7
LinkDB
Position
3629015..3632152
AA seq 1045 aa
MLINATQPEELRVALVDGQRLFDLDIESGAREQKKANIYKGRITRIEPSLEAAFVDFGAE
RHGFLPLKEISREYFKKNPEGRINIKDVLSEGQEVIVQVEKEERGNKGAALTTFISLAGR
YLVLMPNNPRAGGISRRIEGEERNELREALNGLNVPGDMGLIVRTAGLGRSSEELQWDLD
YLLQLWGAIKEASGERSGPFLIYQESNVIIRAIRDYLRQDIGEVLIDSLDAQEEALNFIR
QVMPQYASKVKLYQDSVPLFNRFQIESQIETAFQREVKLPSGGSIVIDPTEALVSIDINS
ARATKGGDIEETALQTNLEAAEEIARQLRLRDIGGLIVIDFIDMTPAKNQRAVEERVREA
LEADRARVQVGRISRFGLLEMSRQRLRPSLGETSGIVCPRCNGQGIIRDVESLSLAILRL
IEEEALKDRTAEVRARVPFQVAAFLLNEKRNAITKIELRTRARIFILPDDHLETPHFEVQ
RLRDDSPELLAGQSSYEMAHIEHEEVQPISSTRTLVRQEAAVKTVSPQTPAPQQTAAAPA
PVVEASKPMPEPSLFQGLVKSLVSLFAGSKPEQPQPAAAEKPAAERSEGQGERRNGRQQN
RRRDGREGGRRDDERKERGERRRDERGERGERAERPAREERQPREERAERQPREERQPRE
ERTERQPREERQPREERAERQPREERQPREERAERQPREERAERQPREERQPREERGERP
AREERQPRGERAERQPREERQPREERQASEAAAVESEELLNEELLDQQDDQEGADGERPR
RRSRGQRRRSNRRERQREAGVDGVEGGEEVSEQTEQAAGEASTAAAIVGATAAVVAEVAT
EQQSDSEAPTEAALPVESNVVEAVRTESALEQTIEFLAKPSETVEQVEASESVAVEAAPV
VEARVEEVVQAAVEAQPEPAAEAPVEAPAADAAVPANATGRASNDPRERRRLERMAREAA
AAAAAAPQVEAAPAVEAVVEETAAVEAEVVTEPAVEVPADAVAAEAVNEAPAIEQTEQSA
AEQTEGENAEKPEEEESNVAEKHHS
NT seq 3138 nt   +upstreamnt  +downstreamnt
atgctgatcaacgcaactcaacccgaagagttgcgtgtagcgctggtagacggccaacgc
ctgttcgacctggacatcgagtccggtgcgcgcgaacagaagaaagccaacatctataaa
gggcgcatcacccgcatcgaacccagcctcgaagccgccttcgtagacttcggcgccgag
cgccacggcttcctccccctcaaagaaatctcccgcgaatacttcaagaagaaccccgaa
ggccgcatcaacatcaaggatgtgctcagcgagggccaggaagtcatcgtccaggtcgag
aaagaggagcgtggcaacaagggcgcggccctgaccaccttcatcagcctcgccgggcgt
tacctggtgctgatgccgaacaatccgcgtgccggcggcatctcccgccgcatcgaaggc
gaagagcgcaatgaactgcgcgaagccctgaacggcctgaacgttcccggcgacatgggt
ctgatcgtccgcaccgccggcctgggccgcagctccgaagagctgcagtgggacctcgac
tacctgctgcaactgtggggcgccatcaaggaagcctcgggcgagcgcagcggtccgttc
ctgatctaccaggaaagcaacgtcatcatccgcgccatccgcgactacctgcgccaggac
atcggcgaagtgctgatcgacagcctcgatgcccaggaagaagccctgaacttcatccgc
caggtcatgccgcagtacgcgagcaaggtgaagctgtaccaggacagcgttccgctgttc
aatcgcttccagatcgaaagccagatcgagaccgccttccagcgcgaagtgaagctgccg
tcgggcggctctatcgtcatcgacccgaccgaagccctggtgtccatcgacatcaactcg
gcgcgcgccaccaagggtggcgacatcgaggaaaccgcgctgcagaccaacctggaagcg
gccgaagagatcgcccgccagctgcgcctgcgcgacattggcggcctgatcgtcatcgac
ttcatcgacatgaccccggcgaagaaccagcgcgccgtggaagagcgtgtgcgtgaagcc
ctggaggccgaccgcgcccgcgtccaggtcggtcgcatctcgcgcttcggcctgctggaa
atgtcccgtcagcgcctgcgtccgtccctgggcgagaccagcggcatcgtctgcccgcgc
tgcaacggccagggcatcatccgcgacgtcgaatccctgtcgctggcgatcctgcgcctg
atcgaggaagaagccctgaaggaccgcaccgccgaagttcgcgcgcgcgtgccgttccag
gttgccgccttcctgctcaacgagaagcgcaacgccatcaccaagatcgagctgcgcacc
cgcgcgcgcatcttcatcctgccggacgaccacctggaaacgccgcacttcgaagtacag
cgcctgcgcgatgacagccccgaactgctggccggccagtccagctacgagatggcccac
atcgagcacgaggaagtccagccgatcagttctacccgtaccctggtccgccaggaagcc
gcggtgaagactgtttccccgcagacccctgccccgcagcagaccgctgccgcacccgca
ccggttgtcgaagcgtccaagccgatgccggagccgagcctgttccagggcctggtgaag
tcgctggtcagcctgttcgccggcagcaagccggagcagccgcaacccgccgccgccgag
aagccggctgccgagcgtagcgaaggccagggcgagcgccgcaacggccgccagcagaac
cgtcgccgcgatggccgcgaaggtggccgtcgtgatgacgagcgcaaggagcgtggcgag
cgtcgccgtgacgagcgtggtgagcgtggcgaacgcgccgagcgtccggctcgcgaagag
cgtcagccgcgtgaagagcgcgccgaacgtcagccccgcgaggagcgtcagccgcgtgaa
gagcgcaccgagcgtcaaccccgcgaggaacgccagccgcgtgaagagcgcgccgagcgt
cagcctcgcgaggaacgccagccgcgcgaagagcgtgccgagcgtcagccccgtgaagag
cgtgccgaacgtcaaccgcgcgaagagcgccagccccgcgaagagcgtggcgagcgtccg
gcccgcgaagagcgtcagccgcgtggcgaacgcgccgagcgtcaaccccgtgaggagcgt
cagccgcgcgaggagcgtcaggccagcgaagccgctgccgtggaatccgaagagctgctg
aacgaggaactgctggaccagcaggatgaccaggaaggcgccgatggcgagcgtcctcgt
cgccgctcccgtggtcagcgccgccgcagcaaccgccgcgagcgtcagcgtgaagccggt
gtcgatggcgtggaaggtggcgaagaagtgagcgagcagaccgaacaggctgctggcgaa
gcatcgactgctgccgccatcgttggcgccactgccgctgtcgttgccgaagttgccacc
gagcagcagtcggacagcgaggcaccgaccgaagccgctctgccggtagagtccaacgta
gtcgaggccgtgcgcaccgaaagcgccctggagcagaccatcgagttcctggccaagccc
agcgaaaccgtcgagcaggttgaagccagcgaaagcgtagcggtggaagccgccccggtc
gttgaagctcgcgtggaagaggtcgtccaggccgctgtcgaagcccagcctgagcctgcc
gccgaagcgccggtcgaagctccggccgccgacgcagcagttccggccaacgccaccggc
cgcgcctccaacgacccgcgcgagcgtcgtcgcctggagcgtatggcccgtgaagccgcc
gcagccgcggccgctgctccgcaggtcgaagcagctccggctgtcgaagcggtggtcgaa
gagaccgcagccgtggaagctgaagtcgtgactgagccggccgtagaggttccagccgat
gccgttgcggcagaagcggtgaacgaagcgcctgccatcgagcagaccgagcaatcggct
gccgagcagactgaaggcgaaaacgccgagaagcccgaggaagaagaaagcaacgtggcg
gaaaaacaccacagctga

DBGET integrated database retrieval system