KEGG   Pseudomonas sp. ATCC 13867: H681_19270
Entry
H681_19270        CDS       T02524                                 
Name
(GenBank) ATP-dependent RNA helicase RhlB
  KO
K03732  ATP-dependent RNA helicase RhlB [EC:3.6.4.13]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    H681_19270
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdr03019]
    H681_19270
Enzymes [BR:pdr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     H681_19270
Messenger RNA biogenesis [BR:pdr03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     H681_19270
SSDB
Motif
Pfam: DEAD Helicase_C ResIII UTP25
Other DBs
NCBI-ProteinID: AGI25721
UniProt: M4X2D2
LinkDB
Position
4313891..4315417
AA seq 508 aa
MLKALKKIFSKGEGEQPVATPAAPAPAASEPAQSGEKRPRKPRNPRPQSESAEKPARGPK
GGKPRAERSEKAERGEKTERTDKPREPRADKPRRERKPRPPVVDNWKLEDFVVEPAEGKT
RFHDFNLDPRLMHAIHDLGFPYCTPIQAQVLGFTLRGQDAIGRAQTGTGKTAAFLISIIT
QLLQTPPPKERYMGEPRALIIAPTRELVVQIANDAIGLAKYTGLNVMSFVGGMDFDKQLR
TLESRFCDILVATPGRLLDFNQRGEVHLDMVEVMVLDEADRMLDMGFIPQVRQIIRQTPY
KGERQTLLFSATFTDDVMNLAKQWTVDPAIVEIEPENVASDTVEQHVYAVAGSDKYKLLY
NLIAQNDWTRVMVFANRKDEVRRIEERLTKDGISAAQMSGDVPQHKRIKVLEGFREGKIR
VLVATDVAGRGIHVDGISHVINFTLPEDPDDYVHRIGRTGRAGTTGTSISFAGEDDAFAL
PPIEELLGRKINCEMPPTELLKPVPRKH
NT seq 1527 nt   +upstreamnt  +downstreamnt
gtgctcaaagcactcaagaaaatcttcagcaaaggcgagggcgagcagcccgtcgccacg
ccggcagcccccgcccccgctgcctccgagcccgcccagagcggtgagaagcgtccgcgc
aaaccgcgcaatccacgcccccagagcgagtccgccgagaagccggcccgtggcccgaag
ggcggcaagccccgcgccgagcgctccgagaaagccgaacgcggcgaaaagaccgaacgc
accgacaagccgcgcgagcccagggccgacaaaccgcgccgcgagcgcaagccgcgcccg
ccggtggtggacaactggaagctggaagacttcgtggtggagccggccgaaggcaagacg
cgtttccacgacttcaacctcgacccgcgcctgatgcacgccatccatgacctgggcttc
ccctactgcacgccgatccaggcacaggtgttgggcttcaccctgcgtggccaggacgcc
atcggccgcgcccagaccggcaccggcaagaccgccgcgttcctcatctcgatcatcacc
cagctgctgcagaccccgccgccgaaagagcgctacatgggcgagccgcgcgcgctgatc
atcgcccccacccgtgagctggtggtgcagatcgccaacgacgccatcggcctggccaag
tacaccggcctgaacgtcatgagcttcgtcggcggcatggacttcgacaagcagctgcgc
accctggaatcgcgcttctgcgacatcctggtcgccacccctggccgcctgctggacttc
aaccagcgcggcgaggtgcacctggacatggtcgaggtgatggtgctggacgaagccgac
cgcatgctcgacatgggcttcatcccccaggtccgccagatcatccgccagaccccgtac
aagggcgagcgccagaccctgctgttctccgccaccttcaccgacgacgtgatgaacctg
gccaagcagtggaccgtcgacccggccatcgtcgagatcgagccggagaacgtcgccagc
gacaccgtcgagcagcacgtctacgccgtggccggcagtgacaagtacaagctgctgtac
aacctgatcgcgcagaacgactggacccgcgtgatggtcttcgccaaccgcaaggacgag
gtgcgccgcatcgaggaacgcctgaccaaggacggcatcagcgccgcccagatgtccggc
gatgtgccgcagcacaagcgcatcaaggttctggaaggcttccgtgaaggcaagatccgc
gtcctggtcgccaccgacgtcgccggtcgcggcatccacgtcgacggcatcagccacgtg
atcaacttcaccctgcccgaagacccggacgactacgtgcaccgcatcggccgtaccggc
cgcgccggcaccaccggtacctccatcagcttcgccggcgaagacgatgccttcgccctg
ccgccgatcgaggaactgctgggccgcaagatcaactgcgaaatgccgcccaccgagctg
ctcaagccggtaccgcgcaagcactga

DBGET integrated database retrieval system