KEGG   Pseudomonas sp. ATCC 13867: H681_20965
Entry
H681_20965        CDS       T02524                                 
Name
(GenBank) poly(A) polymerase
  KO
K00970  poly(A) polymerase [EC:2.7.7.19]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    H681_20965
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdr03019]
    H681_20965
Enzymes [BR:pdr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.19  polynucleotide adenylyltransferase
     H681_20965
Messenger RNA biogenesis [BR:pdr03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     H681_20965
SSDB
Motif
Pfam: PolyA_pol_arg_C PolyA_pol PolyA_pol_RNAbd
Other DBs
NCBI-ProteinID: AGI26060
UniProt: M4XLC1
LinkDB
Position
4694031..4695440
AA seq 469 aa
MLKKLIQSIRSPLRRPRAVRTTPEVVGNHQHSLRREQFSRNAVNVVERLTKAGYQAYIVG
GGVRDPLLGITPKDFDVATSATPEQVRAEFRNARVIGRRFKLVHVHFGREIIEVATFRAN
HPQTDDDTDSAHASRNEAGRILRDNVYGTLEDDAQRRDFTINALYFDVTGERILDYAHGV
HDIRNRLVRLIGDPEQRYLEDPVRMLRAVRFAAKLGFEIEKHSAAPIRRLAHLLNEIPSA
RLFDEVLKLLLSGKAERTFELLNEYDLFAPLFPASAKALKENPEYAGKLMRQALANTDER
IRQGKPVTPAFLFAALLWPALPARVLKLQERGVPPIPAMQDAAHELIIEQCKRTAVPKRF
TIPIREIWDMQERLPRRQGKKADLLLENPRFRAGYDFLLLRESAGEETGGLGDWWTDYQE
ASDGERRGMIRNLSSQEESSGGVPRKRRRGGANRRRRGPRNSGEGTGNE
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgctgaaaaagctgatccagtccatccgatccccactgcgccgtccgcgcgctgtccgc
actactccggaagtcgttggcaatcatcagcactcgctgcggcgggaacagttcagcagg
aacgcggtgaacgtcgtggagcgcctgaccaaggccggctaccaggcgtacatcgtcggt
ggcggcgtacgtgatccgctgctgggtattacccccaaggacttcgacgtggccaccagc
gccacccccgagcaggttcgcgccgagttccgcaacgcgcgggtgatcggccgtcgcttc
aagctggtccatgtccacttcggccgcgagatcatcgaagtcgccaccttccgcgccaac
catccgcagaccgacgacgacaccgacagcgcccatgcctctcgcaacgaggccggccgc
atcctgcgcgacaacgtctatggcacgctggaagacgacgcgcagcgccgcgacttcacc
atcaacgccctgtatttcgatgtcaccggcgagcgcatcctcgactacgcccacggcgtg
catgacatccgcaaccgcctggtgcgcctgatcggcgaccctgagcagcgctacctcgaa
gacccggtgcgcatgctgcgcgccgtacgcttcgccgccaagctgggcttcgagatcgag
aaacacagcgccgcgccgatccgccgcctggcgcacctgctcaacgaaatcccctcggcg
cgcctgttcgacgaagtgctcaagctgctactgagcggcaaggccgagcgcaccttcgag
ctgctcaacgaatacgacctgttcgcgccgttgttcccggccagcgccaaggcgctgaaa
gagaatcccgaatacgccggcaagctgatgcgccaggcgctggccaacaccgacgagcgc
attcgccagggcaagccggtcactccggccttcctgttcgccgcgctgctctggcccgcc
ctgcccgcgcgcgtactgaaactgcaggagcgcggcgtgccgccgatcccggccatgcag
gacgccgcccacgaactgatcatcgaacagtgcaagcgcactgcggtgcccaagcgcttc
accatcccgatccgcgagatctgggacatgcaggaacgcctgccgcgccgccagggcaag
aaggccgacctgctgctggaaaacccgcgcttccgtgccggctacgacttcctcctgctg
cgcgaaagcgccggcgaggaaaccggtggcctgggcgattggtggaccgactaccaggaa
gccagcgatggcgaacgccgcggcatgatccgcaacctctccagccaggaagaaagcagc
ggtggcgtaccgcgcaaacgccgtcgtggcggtgccaaccgtcgccggcgcggtccgcgt
aacagtggcgaaggcaccggtaacgaatga

DBGET integrated database retrieval system