KEGG   Pseudomonas sp. ATCC 13867: H681_22110
Entry
H681_22110        CDS       T02524                                 
Name
(GenBank) ribonuclease R
  KO
K12573  ribonuclease R [EC:3.1.13.1]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    H681_22110
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdr03019]
    H681_22110
   03016 Transfer RNA biogenesis [BR:pdr03016]
    H681_22110
Enzymes [BR:pdr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     H681_22110
Messenger RNA biogenesis [BR:pdr03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     H681_22110
Transfer RNA biogenesis [BR:pdr03016]
 Prokaryotic type
  tRNA degradation factors
   H681_22110
SSDB
Motif
Pfam: RNB CSD2 OB_RNB S1 HTH_12 RNase_II_C_S1 OB_Dis3 LexA_DNA_bind
Other DBs
NCBI-ProteinID: AGI26289
UniProt: M4X2G4
LinkDB
Position
complement(4938500..4941238)
AA seq 912 aa
MADWQNLDPEAAREAEKYENPIPSRELILAHLAERGAPATRAQLLDEFGLSGEESEEALR
RRLRAMERDGQLIYTRRGAYAPVDKLDLILGRIAGHRDGFGFLIPDDGSDDLFLSPTQMR
LVFDGDRALARVSGFDRRGRREGAIVEVVERAHETIVGRYFDESGIGTVVADNPKIQQEV
LIPPGKAGKAKHNQFVQVRIDVWPSVHRQAQGEVLEVLGDYMAPGMEIEVALRSYDIPHT
WPEAVEKEAAKLKPEVAEKDKEKRVDLRALPFVTIDGEDARDFDDAVYAEKRKGGGWKLF
VAIADVSHYVKVGSALDEEAAKRGNSVYFPGRVIPMLPEILSNGLCSLNPLVDRLAMVCE
MNLSKAGKMTDYQFYEAVIHSHARLTYTKVSQYLETPDSSEGQRLKEQLPAVVPHLNTLY
DLYKVLVGARHVRGAIDFETQETRIVFGADRKISEIRPTQRNDAHKLIEECMLAANVATA
KFLEKHAIPALYRVHDGPPQEKLNNLRQFLGELGLTLYRGKGEPTPADYQKLLESIQGRP
DLQLIQTVMLRSLSQAVYSPENAGHFGLNYEAYTHFTSPIRRYPDLLTHRAIRGLIRSKA
ASEHVQRVGAASMPKARIYPYDEVRLAQLGEQCSMTERRADEATRDVTNWLKCEFMRERV
GETFPGVITAVTGFGIFVELTDIYVEGLVHVTALPGDYYHFDAVHHRLSGERTGRSFRLG
DTVEVVVARVDLDERKIDFELSDNVLSAPIGRKKRGEKAEPAKGKVAKGKAPKGAAAKEK
PAKARRQVADDPFFAPDVAVVPSHQPRKRKVGVVQALPSVAPEMLAKAEEMLGNTDVRKS
REVKKALLDEAKVGSKKPANGKGKGAPAAGKPRNPSKQKARSAKPTKHRKGSSAPKAGAA
GGAPASKRKAKK
NT seq 2739 nt   +upstreamnt  +downstreamnt
atggccgattggcaaaacctcgatcccgaggccgcccgcgaggcggaaaaatacgaaaac
cccatccccagccgcgaactcatcctggcgcatctcgccgaacgcggcgcgcctgccacg
cgggcccaattgctcgatgaattcggtctctccggcgaagagtcggaagaggcgctgcgc
cggcgcttgcgcgcgatggagcgcgacggccagctcatctatacccgccgtggcgcctac
gcgccggtggacaagctcgacctgatcctcggccgcatcgccggccaccgcgacggcttc
ggcttcctgatccccgatgacggcagcgacgacctgttcctcagcccgacgcagatgcgc
ctggtgttcgacggcgaccgtgccctggcgcgcgtgtccggcttcgatcgccgtggccgc
cgcgaaggtgccattgtggaagtggtcgaacgcgcccacgagaccatcgtcggccgctac
ttcgacgagagtggcatcggtacggtggtggccgacaacccgaagatccagcaggaagtg
ctgatcccgccgggcaaggccggcaaggccaagcacaaccagttcgtccaggtgcgtatc
gatgtctggccgagcgtgcatcgccaggcccagggtgaggtgctggaagtgctcggcgac
tacatggcgccgggcatggagatcgaagtcgccctgcgcagctacgacattccccacacc
tggcccgaggccgtggagaaggaagcggccaagctcaagcccgaagtggcggaaaaggac
aaggagaagcgcgtcgacctgcgcgccctgcctttcgtgaccatcgatggtgaggacgcc
cgcgacttcgacgacgcggtctacgccgagaagcgcaagggtggcggctggaagctgttc
gtcgccatcgccgacgtctctcattatgtgaaggtcggctcggccctggatgaggaggcg
gccaagcgcggcaactcggtgtacttccccgggcgcgtgatcccgatgctgccggagatc
ctctccaacggcctgtgctccctgaatccgctggtcgatcgcctggccatggtctgcgag
atgaatctctccaaggccggcaagatgaccgactaccagttctacgaggcggtcatccat
tcccatgcgcgcctgacctacaccaaggtcagccagtacctggaaaccccggacagctcc
gaaggccagcgcctgaaggagcagttgccggcggtggtgccgcacctgaacacgctttat
gacctgtacaaggtgctggtcggcgcgcgccacgtgcgcggggcgatcgacttcgagacc
caggaaacccgcatcgtcttcggtgcggatcgcaagatctcggagatccgcccgacccag
cgcaacgacgcgcacaagctgatcgaggaatgcatgctggcggccaacgtcgccaccgcc
aagttcctcgagaagcacgctatcccggcgctgtaccgcgtccacgacggtccgccgcag
gagaagctgaacaacctgcggcagttcctcggcgaactgggcctgaccctgtatcgcggc
aagggcgagccgaccccggcggattaccagaagctgttggagtcgatccagggtcgcccg
gacctgcaactgatccagaccgtgatgctgcgctccctgagccaggcggtgtacagcccg
gagaacgccggccacttcggcctgaactacgaggcctacacccacttcacctcgccgatc
cggcgctacccggacctgctgacccatcgcgccatccgcggcctgatccgctccaaggcg
gcctccgagcacgtacagcgtgtcggcgccgccagcatgcccaaggcgcgcatctatccg
tacgacgaagtccgcctggcgcaactgggcgagcagtgctcgatgaccgagcgccgagcc
gacgaggcgacccgcgacgtcaccaactggctgaagtgcgagttcatgcgcgagcgcgtg
ggcgagaccttccccggcgtgatcaccgcggtgaccggcttcggcatcttcgtcgaactg
acggacatctatgtcgagggcctggtccacgttaccgcactgccgggcgactactaccat
ttcgatgccgtccaccatcgcctctccggcgagcgtaccggccgtagcttccgccttggc
gacaccgtggaagtggtggtggcgcgcgtcgacctggacgagcgcaagatcgacttcgag
ctctccgataacgtgctcagcgcgcccatcggccgcaagaagcgtggcgagaaggctgag
ccggccaagggcaaggttgcgaagggcaaggcgcccaaaggtgctgcagccaaagagaag
ccggccaaggcccgtcgtcaggtagcggacgatccgttcttcgcgcccgacgtggccgtg
gtgccgtcgcaccagccgcgcaagcgcaaggttggcgtggtccaggcgctgccttcggtg
gccccggaaatgctggccaaggccgaggaaatgcttggcaataccgatgtgcgcaagagc
cgcgaagtgaagaaagcgctgctcgatgaagccaaggtcggcagcaagaaaccggccaac
ggcaaaggcaagggcgcgcccgctgcgggcaagccgcgcaatccttcgaaacagaaagcc
cggtccgccaagccgaccaagcatcgcaagggctcgtccgcgcccaaggcgggtgcggcg
ggcggcgcgccggccagcaagcgtaaggcgaagaaatga

DBGET integrated database retrieval system