Pseudomonas sp. ATCC 13867: H681_22145 Help Entry H681_22145        CDS       T02524                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism pdr  Pseudomonas sp. ATCC 13867 Pathway pdr02024   Quorum sensing pdr03018   RNA degradation Brite KEGG Orthology (KO) [BR:pdr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     H681_22145 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     H681_22145 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pdr03019]     H681_22145 (hfq)    03036 Chromosome and associated proteins [BR:pdr03036]     H681_22145 (hfq) Messenger RNA biogenesis [BR:pdr03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      H681_22145 (hfq) Chromosome and associated proteins [BR:pdr03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     H681_22145 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Motif Other DBs NCBI-ProteinID:  AGI26296 UniProt:  M4X3Z9 LinkDB All DBs Position complement(4948522..4948770) Genome browser AA seq 82 aa AA seqDB search MSKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVRLPSGDQPAEPGNV NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttacctcaataccctgcgcaaagagcgcgtc ccggtttccatctatctggtcaacggcatcaagttgcaggggcagatcgaatccttcgac cagttcgttattctgctgaagaacactgtcagccagatggtctacaagcacgctatctcc accgttgttcccagccgtccggtgcgtctgcccagcggtgatcagccggccgagccgggc aacgtttga

DBGET integrated database retrieval system