KEGG   Pseudomonas sp. ATCC 13867: H681_22145
Entry
H681_22145        CDS       T02524                                 
Symbol
hfq
Name
(GenBank) RNA-binding protein Hfq
  KO
K03666  host factor-I protein
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr02024  Quorum sensing
pdr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    H681_22145 (hfq)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    H681_22145 (hfq)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdr03019]
    H681_22145 (hfq)
   03036 Chromosome and associated proteins [BR:pdr03036]
    H681_22145 (hfq)
Messenger RNA biogenesis [BR:pdr03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     H681_22145 (hfq)
Chromosome and associated proteins [BR:pdr03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucleoid associated proteins
    H681_22145 (hfq)
SSDB
Motif
Pfam: Hfq LSM
Other DBs
NCBI-ProteinID: AGI26296
UniProt: M4X3Z9
LinkDB
Position
complement(4948522..4948770)
AA seq 82 aa
MSKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS
TVVPSRPVRLPSGDQPAEPGNV
NT seq 249 nt   +upstreamnt  +downstreamnt
atgtcaaaagggcattcgctacaagacccttacctcaataccctgcgcaaagagcgcgtc
ccggtttccatctatctggtcaacggcatcaagttgcaggggcagatcgaatccttcgac
cagttcgttattctgctgaagaacactgtcagccagatggtctacaagcacgctatctcc
accgttgttcccagccgtccggtgcgtctgcccagcggtgatcagccggccgagccgggc
aacgtttga

DBGET integrated database retrieval system