KEGG   Pseudomonas sp. ATCC 13867: H681_22640
Entry
H681_22640        CDS       T02524                                 
Name
(GenBank) penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00550  Peptidoglycan biosynthesis
pdr01100  Metabolic pathways
pdr01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    H681_22640
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    H681_22640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pdr01003]
    H681_22640
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pdr01011]
    H681_22640
Enzymes [BR:pdr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     H681_22640
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     H681_22640
Glycosyltransferases [BR:pdr01003]
 Polysaccharide
  Bacterial polysaccharide (excluding LPS)
   H681_22640
Peptidoglycan biosynthesis and degradation proteins [BR:pdr01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   H681_22640
SSDB
Motif
Pfam: Transgly Transpeptidase PCB_OB
Other DBs
NCBI-ProteinID: AGI26395
UniProt: M4XME6
LinkDB
Position
5076545..5078971
AA seq 808 aa
MRLLKFLWWTCVTIICGLLLSFSGAYLYLSPNLPSVEALRNVRLQMPLRVYSSDNRLIAE
FGEMRRTPIRFAEIPQDFTHALLSAEDDNFANHYGVDVKSLMRAAAQLLKTGHIQTGGST
ITMQVAKNYFLTNERSFSRKINEILLALQIERSLTKDEILELYVNKIYLGNRAYGVEAAA
QVYYGKSIKDLSLAQMAMIAGLPKAPSRYNPLANPARSLERRNWILERMLKLGFIDQPRY
EAAVKEPIAASYHVQSPELTAPYIAEMARAELVGRFGGDAYTEGYRVYTTVRSDLQEDAN
NALRDGLQDYDQRHGYRGPETRLPGKTRDAWRQAIAQQRPLGGLEPAIVIQVEKSGALVM
TRDGKEEALAWDGMKWARPYLSNNSMGPMPRQPSDVVQPGDVIRVQRRDDGSLRLSQVPA
AQSALVSLNPQDGAIMALVGGFSFEQSNYNRATQAKRQPGSSFKPFIYSAALDNGFTAAS
LINDAPVVFYDEYLDKVWRPKNDTNTFLGPIPMREALYKSRNMVSIRILQGLGVERARNY
ISRFGFNKDELPPNLSMALGTATLTPLEIATAWSTFANGGFKISPYVIERIESRDGQIIY
QANPPRVTNDEAQVEQAQPTGTNELGNDDPSLAKTTIEPAAAERIIDSRTAYIMTSMLQD
VIKRGTGRRALALKRDDLAGKTGTTNESKDAWFSGYNADYMTTVWVGFDQPESLGRSEYG
GNVALPIWMRYMGAALKDKPSHLLPEPAGMVSLRIDPVTGRAAAPGTPGAYFELFKNEDT
PPSMSELAPGSAPGSGMPAEEEAPIDLF
NT seq 2427 nt   +upstreamnt  +downstreamnt
atgcgcctgctgaagtttctgtggtggacctgcgtcaccataatctgtggattgctgctc
agtttcagcggcgcctacctctacctcagcccaaacctcccgtccgtggaggccttgcgc
aacgtgcgtttgcagatgccgttgcgcgtgtacagcagtgataacagattgatagcagag
tttggcgagatgcgccgtacgccgattcgctttgctgaaatcccccaagacttcacccac
gcactgttatcggccgaggatgacaacttcgccaatcattatggcgtggacgtcaagagc
ctgatgcgtgctgccgcgcaattattgaagacgggacatatccagacgggcggcagcacc
atcaccatgcaggtggcgaagaactacttcctcaccaacgaacgcagcttctcccggaag
atcaacgagatcttgctggcacttcagatcgagcgctcgctgaccaaggacgagatcctc
gagctgtacgtcaacaagatttatctgggcaaccgcgcttacggtgtagaagccgccgcc
caggtctattacggcaaatcgatcaaagacttgagcctggcccagatggcgatgatcgcc
ggtctgcccaaggcgccgtcgcgctacaacccgctggccaaccccgcccgcagcctggaa
cgccgcaactggatcctcgagcgcatgctcaagctgggcttcatcgaccagcctcgctac
gaagccgcggtcaaggaacccatcgcggcgtcctatcacgtacaaagcccggagctgacc
gccccttacatcgccgagatggcgcgcgccgagctggtcggccgcttcggcggcgatgcc
tacaccgagggctaccgcgtctataccaccgtgcgcagcgatctgcaggaggacgccaac
aacgcactgcgcgacggcctgcaggattacgaccagcgtcacggctaccgtggcccggag
acccgcctgcccggcaagacccgcgatgcctggcgccaggcgatcgcccagcaacgcccg
ctcggcggcctggagccggccatcgtcatccaggtggagaagagcggcgccctggtgatg
acccgcgacggcaaggaagaagcactcgcctgggacggcatgaaatgggcgcgcccctac
ctcagcaacaacagcatggggccgatgcctcgccagccaagcgacgtggtccagcccggc
gacgtgatccgtgtgcaacgccgcgacgacggctcgctgcgcctgagccaggtgcccgcc
gcacaaagcgcgctggtttccctgaacccgcaggacggcgcgatcatggcgctggtcggt
ggtttctccttcgagcagagcaactacaaccgcgcgacccaggccaagcgccagcccggt
tccagcttcaagccgttcatctacagcgccgcgctggacaacggtttcaccgccgcctcg
ctgatcaacgacgcccccgtggtgttctacgatgagtacctggacaaggtctggcgaccg
aagaacgacaccaacaccttcctcggcccgatcccgatgcgcgaggcgttgtacaagtcg
cgcaacatggtgtcgatccgcatcctccaggggctgggcgtcgaacgcgcgcgcaactac
atcagccgcttcggtttcaacaaggacgaactgccgccgaacctgtcgatggccctcggc
accgcgaccctgacgccgctggagatcgccaccgcctggagcaccttcgccaacggtggc
ttcaagatttcgccctatgtgatcgagcgcatcgaaagccgcgacggccagatcatctac
caggccaacccgccccgcgtgacgaatgacgaggcacaggtcgaacaggcacagcccacc
ggcaccaacgaactgggcaacgacgacccgagcctggccaagaccaccatcgagccggcc
gccgccgagcgcatcatcgactcgcgcaccgcctacatcatgaccagcatgctgcaggac
gtgatcaagcgcggcaccggccgtcgcgccctggcgctcaagcgcgacgacctggccggc
aagaccggtaccaccaacgagtccaaggacgcctggttctccggctacaacgccgactac
atgaccaccgtctgggtcggtttcgaccagccggaaagcctcggccgcagcgagtacggc
ggtaacgtggccctgccgatctggatgcgctacatgggcgccgccctgaaggacaagccc
tcgcacctgctgcccgagcccgccggcatggtcagcctgcgcatcgatccggtgactggc
cgcgcagcggcgccaggcacgccgggcgcctatttcgaactgttcaagaacgaggatacg
ccgccttcgatgagcgaactggcaccgggaagcgcgccgggaagcggtatgccggcggaa
gaagaagccccgatcgacctgttctga

DBGET integrated database retrieval system