Pseudomonas entomophila: PSEEN4448 Help Entry PSEEN4448         CDS       T00362                                  Symbol hupN Name (GenBank) DNA-binding protein HU form N   KO K03530   DNA-binding protein HU-beta Organism pen  Pseudomonas entomophila Brite KEGG Orthology (KO) [BR:pen00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pen03032]     PSEEN4448 (hupN)    03036 Chromosome and associated proteins [BR:pen03036]     PSEEN4448 (hupN)    03400 DNA repair and recombination proteins [BR:pen03400]     PSEEN4448 (hupN) DNA replication proteins [BR:pen03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     PSEEN4448 (hupN) Chromosome and associated proteins [BR:pen03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     PSEEN4448 (hupN) DNA repair and recombination proteins [BR:pen03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       PSEEN4448 (hupN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 SSPI Motif Other DBs NCBI-ProteinID:  CAK17131 UniProt:  Q1I5F4 LinkDB All DBs Position complement(4762067..4762348) Genome browser AA seq 93 aa AA seqDB search MALTKDQLIADIAESIDAPKTTARAALEQLGQIVADQLENGAEITLPGIGKLKVSERPAR TGRNPSTGAAIEIAAKKVVKFVPAKVLTDSINK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggcactgaccaaagaccaactgattgccgatatcgccgaatccatcgacgcgccgaaa accaccgcgcgcgctgccctggagcaactgggccagatcgtcgccgaccaactggaaaac ggcgctgaaatcaccctgccaggcatcggcaagctgaaagtctccgagcgtcctgcccgt accggccgcaacccttcgactggcgccgccatcgaaatcgctgccaagaaagtcgtcaag ttcgttccagccaaagtgctgaccgactcgatcaacaagtaa

DBGET integrated database retrieval system