KEGG   Plasmodium falciparum Dd2: PFDG_00795
Entry
PFDG_00795        CDS       T01051                                 

Definition
(Broad) hypothetical protein
  KO
K22101  dihydroneopterin triphosphate aldolase (PTPS-III) / 6-pyruvoyltetrahydropterin synthase [EC:4.1.2.60 4.2.3.12]
Organism
pfd  Plasmodium falciparum Dd2
Pathway
pfd00790  Folate biosynthesis
pfd01100  Metabolic pathways
pfd01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:pfd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PFDG_00795
Enzymes [BR:pfd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.60  dihydroneopterin triphosphate aldolase
     PFDG_00795
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.12  6-pyruvoyltetrahydropterin synthase
     PFDG_00795
SSDB
Motif
Pfam: PTPS
LinkDB
Structure
PDB: 
1Y13

AA seq 173 aa
MMKEETLNSDNSSAEVSVESPSFSFNCAHFIAYNGFRETLHGHNYNVSLKVRGYVRDDGY
VIDFSILKEKVKKVCNKLDHHFILPIYSDVLKFENVKNNIKIICEDNSEYSFPERDCIKL
PIKHSSTEEIGQYILNQLIEEMDVSLLKSRHIHYIEISVSESPTQKAIVHKYI
NT seq 522 nt   +upstreamnt  +downstreamnt
atgatgaaagaggaaaccctaaattcagataacagttctgctgaagtttctgtggagtca
ccttctttttcatttaattgtgcacattttatagcatacaatggttttcgagaaacctta
catggtcataattataacgtctctttaaaagttcgaggatatgtcagagatgatggatat
gtaatagatttttccatattaaaagaaaaagtaaaaaaagtgtgtaataaattagatcat
cattttatattacctatatatagtgatgtgttaaaatttgaaaatgtaaaaaataatata
aaaatcatatgtgaagataattcagaatattctttcccagaaagagattgtataaaactt
cctattaaacattcttctactgaagaaattggacaatacattcttaaccaactaatagaa
gaaatggatgtttcccttttaaaatcaagacatatacattatatagaaataagtgtcagt
gaatcacctacacaaaaggccatagtccacaaatatatataa

DBGET integrated database retrieval system