KEGG   Pyrococcus furiosus COM1: PFC_05605
Entry
PFC_05605         CDS       T02183                                 

Definition
(GenBank) 6-pyruvoyl-tetrahydropterin synthase
  KO
K22102  dihydroneopterin phosphate aldolase [EC:4.1.2.59]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
pfi00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:pfi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PFC_05605
Enzymes [BR:pfi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.59  dihydroneopterin phosphate aldolase
     PFC_05605
SSDB
Motif
Pfam: PTPS
Other DBs
NCBI-ProteinID: AFN04062
UniProt: I6U7U0
LinkDB
Position
complement(1006248..1006592)
AA seq 114 aa
MKARIIYRASFDAAHAVKIEEWEELHGHTFSLEVVVEGEIKKGYVMDFLKLKKVVDGVVK
ELDHRNLNKIMDNPTTENIALWISERIRKNLPGDVKLKRLSLWEGNEFGVELEW
NT seq 345 nt   +upstreamnt  +downstreamnt
atgaaggctaggattatctatagagcttcttttgatgcagcacacgcagttaagattgaa
gagtgggaagaacttcatggccatacattttctcttgaagttgttgttgaaggagagata
aagaaaggatatgtcatggactttcttaagcttaagaaagtagttgatggtgttgtaaag
gaactcgaccacagaaacctcaacaaaattatggacaatccaactacggaaaacatagcc
ctttggatatctgagagaattagaaagaacctcccaggtgatgtaaagctcaagagactt
tccctttgggaaggtaacgagtttggagtggaactggaatggtga

DBGET integrated database retrieval system