Poecilia formosa (Amazon molly): 103132035 Help Entry 103132035         CDS       T07984                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism pfor  Poecilia formosa (Amazon molly) Pathway pfor03082   ATP-dependent chromatin remodeling pfor04217   Necroptosis Brite KEGG Orthology (KO) [BR:pfor00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     103132035  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103132035  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pfor03036]     103132035   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pfor04147]     103132035 Chromosome and associated proteins [BR:pfor03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103132035 Exosome [BR:pfor04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103132035 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  103132035 NCBI-ProteinID:  XP_007543851 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKPVKSK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtctggcagagggaagaccggaggcaaagccagagccaaggccaaatctcgatcctct cgagccgggctccagttcccggttggtcgagtccacaggctgctccgcaaagggaactac gcggagcgcgtcggcgccggagccccggtatatctggcggcggtgctggagtatttgacc gccgagatcctggagctggcaggcaacgcggcgagggacaacaagaagacccggatcatc ccccgccacctgcagcttgccgtgcgcaacgacgaggagctcaacaagctactaggaggt gtgaccatcgctcaagggggggtcctgcccaacatccaggctgtcctcctcccgaagaaa accgagaaacccgtcaagagcaagtga

DBGET integrated database retrieval system