KEGG   Pyrococcus furiosus DSM 3638: PF1278
Entry
PF1278            CDS       T00075                                 

Definition
(GenBank) hypothetical protein
  KO
K22102  dihydroneopterin phosphate aldolase [EC:4.1.2.59]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
pfu00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:pfu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PF1278
Enzymes [BR:pfu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.59  dihydroneopterin phosphate aldolase
     PF1278
SSDB
Motif
Pfam: PTPS
Other DBs
NCBI-ProteinID: AAL81402
UniProt: E7FHF1
LinkDB
Position
complement(1208389..1208733)
AA seq 114 aa
MKARIIYRASFDAAHAVKIEEWEELHGHTFSLEVVVEGEIKKGYVMDFLKLKKVVDGVVK
ELDHRNLNKIMDNPTTENIALWISERIRKNLPGDVKLKRLSLWEGNEFGVELEW
NT seq 345 nt   +upstreamnt  +downstreamnt
atgaaggctaggattatctatagagcttcttttgatgcagcacacgcagttaagattgaa
gagtgggaagaacttcatggccatacattttctcttgaagttgttgttgaaggagagata
aagaaaggatatgtcatggactttcttaagcttaagaaagtagttgatggtgttgtaaag
gaactcgaccacagaaacctcaacaaaattatggacaatccaactacggaaaacatagcc
ctttggatatctgagagaattagaaagaacctcccaggtgatgtaaagctcaagagactt
tccctttgggaaggtaacgagtttggagtggaactggaatggtga

DBGET integrated database retrieval system