KEGG   Polistes fuscatus (common paper wasp): 122522345
Entry
122522345         CDS       T07683                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
pfuc  Polistes fuscatus (common paper wasp)
Pathway
pfuc00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:pfuc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    122522345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pfuc00199]
    122522345
Enzymes [BR:pfuc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     122522345
Cytochrome P450 [BR:pfuc00199]
 Cytochrome P450, animal type
  CYP306 family
   122522345
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 122522345
NCBI-ProteinID: XP_043499324
LinkDB
Position
Unknown
AA seq 494 aa
MSIFLIILTFLLLVIFYYTNRKKHRLPPGPLGLPIVGYLPWLNPKAPHQTLTQLTRKYGP
ICGLKMGSVYTVLLSDPRLIRQVLAKGTFSGRAPLYLTHGIMRGYGLICAEGELWKDQRK
FVAGCLKNLGMVKFGLKRDKMEGRILAVVNECISKLKDRSTEDGFDPNETLHHCVGNLMN
DLVFGKTYDEDDRVWTWLRKLQEEGVKHIGVAGPLNFLPFLRFLPQYGKTMYNLIDGKVQ
THQIYQKIIDEHRSNPVNNDSILSAFNDEMTNRMMESNNLGYFTEQQYYHLLADIFGAGT
DTTLTTLRWFLLFVAAYPQEQEKIRREMQQVLSDKEPTLEDRIILTRLEATIAEVQRLRS
VVPVGIPHGTIEDTQIGEYDIPKGTMIVPLQWSIHTNPSYWKDPLDFKPDRFIADDGSLA
KPEAFLPFQTGKRSCVGDELAKMILFLFSARILHRFVISIPPNVSSIDFEGECGITLIPK
PHRLVFTLRENLTN
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgtcgatatttctgatcattttaactttcctactattggtcatattttattacaccaat
cgtaagaaacatcgattaccaccgggcccattaggcttaccaatagtaggttatttgcca
tggttgaatccaaaagctccccatcaaacgctcacccaactgaccagaaaatatgggcca
atttgtggattgaaaatgggatccgtttatacggttttattatcggatcctcgattgata
cgacaggtacttgccaagggtaccttttctggaagagcaccattatatttgactcatgga
ataatgcgtggttatggtctgatttgcgccgagggtgaactttggaaagatcaaaggaag
ttcgttgcaggatgcttgaaaaatctaggaatggtcaaattcggattgaaaagggataag
atggaaggaagaattctcgcagttgtaaatgaatgcatttcgaaattgaaggatcgatct
acggaagatggtttcgatccgaacgagacgttgcatcattgcgtaggaaatttgatgaac
gatctcgtgttcggtaaaacttacgacgaggacgatcgtgtttggacgtggcttcgaaaa
ttacaagaggaaggagttaaacacataggcgttgcgggaccattaaattttttaccattt
cttagatttttgccgcaatacggtaaaacgatgtacaatctgatcgatggcaaagtacaa
actcatcaaatttatcaaaaaattatcgatgaacatcgatcaaatcccgttaacaacgat
agtattttatccgcattcaacgatgaaatgacgaacagaatgatggaatcgaacaacctt
ggatattttaccgaacaacaatattatcatttgctcgctgacattttcggtgcaggaaca
gatacgaccttgactactctacgttggtttcttcttttcgtggctgcttatccgcaggaa
caggaaaagattcgtcgagagatgcaacaggtgttatcagataaagaaccaacattggag
gatagaattattttgacgcgtttagaagcaacaatagcggaagtacaaaggcttagaagt
gttgttccagttggtatacctcacggaactatcgaggatacccaaataggtgaatatgat
attccaaaaggtacaatgatcgtaccattgcaatggtccattcatacaaatccatcttat
tggaaagatcctttagatttcaaacctgacagattcattgccgacgatggtagcctcgct
aaaccggaagcattcttgcctttccaaactggaaaacgtagctgcgttggagacgaatta
gcaaaaatgattttgtttttattctcggcaaggattcttcatcgattcgttatttcgatt
ccaccaaacgtttcatcgatagattttgaaggagaatgtggtatcactttaattccaaaa
cctcatcgtttggtttttactcttcgtgaaaatcttaccaattga

DBGET integrated database retrieval system