Pseudomonas simiae PCL1751: PF1751_v1c04880 Help Entry PF1751_v1c04880   CDS       T03766                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pfw  Pseudomonas simiae PCL1751 Pathway pfw02024   Quorum sensing pfw03018   RNA degradation Brite KEGG Orthology (KO) [BR:pfw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     PF1751_v1c04880 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     PF1751_v1c04880 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pfw03019]     PF1751_v1c04880 (hfq)    03036 Chromosome and associated proteins [BR:pfw03036]     PF1751_v1c04880 (hfq) Messenger RNA biogenesis [BR:pfw03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      PF1751_v1c04880 (hfq) Chromosome and associated proteins [BR:pfw03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     PF1751_v1c04880 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AJP50195 UniProt:  A0A370XT31 LinkDB All DBs Position 570503..570763 Genome browser AA seq 86 aa AA seqDB search MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVILLKNTVSQMVYKHAIS TVVPVRPIRLPSAAGDDAADAEPGNA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttacttgaatactttacgtaaagagaaagtg ggggtttccatctacctggtcaacggtatcaagctgcagggcacgatcgagtcgttcgac cagttcgtgatcctgctgaagaacaccgtcagccagatggtctacaagcacgctatctcg acagtcgttccagttcgtccaatccgtctgcctagcgcagcaggtgatgatgcagctgac gctgagccaggtaacgcctga

DBGET integrated database retrieval system