Pseudomonas lurida: A7318_02445 Help Entry A7318_02445       CDS       T04730                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pfx  Pseudomonas lurida Pathway pfx02024   Quorum sensing pfx03018   RNA degradation Brite KEGG Orthology (KO) [BR:pfx00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     A7318_02445  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     A7318_02445  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pfx03019]     A7318_02445    03036 Chromosome and associated proteins [BR:pfx03036]     A7318_02445 Messenger RNA biogenesis [BR:pfx03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      A7318_02445 Chromosome and associated proteins [BR:pfx03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     A7318_02445 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AOE77476 UniProt:  A0A5E6MZX8 LinkDB All DBs Position complement(589468..589728) Genome browser AA seq 86 aa AA seqDB search MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVILLKNTVSQMVYKHAIS TVVPVRPIRLPSAAGDDVADAEPGNA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttacttgaatactttacgtaaagagaaagtg ggggtttccatctacctggtcaacggtatcaagctgcaaggcacgatcgagtcgttcgac cagttcgtgatcctgctgaaaaacaccgtcagccagatggtctacaagcacgctatctcg acagtcgttccagttcgtccaatccgtctgcctagcgcagcgggtgatgatgtagctgac gctgagccaggtaacgcctga

DBGET integrated database retrieval system