Pteropus vampyrus (Indian flying fox): 120603633 Help Entry 120603633         CDS       T07511                                  Symbol GHRH Name (RefSeq) somatoliberin   KO K05260   growth hormone-releasing hormone Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig04080   Neuroactive ligand-receptor interaction pgig04081   Hormone signaling pgig04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:pgig00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     120603633 (GHRH)    04081 Hormone signaling     120603633 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     120603633 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pgig04052]     120603633 (GHRH) Cytokines and neuropeptides [BR:pgig04052]  Neuropeptides   GPCR binding    120603633 (GHRH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  120603633 NCBI-ProteinID:  XP_039720231 UniProt:  A0A6P3QRH6 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MLLWVFFIMILTLSNGSHSSPPSLPLRMPRYADAIFTNGYRKVLGQLSARKLLQDIMSRQ QGERNQEQGAKVRSGRQVDSMWADRKQMALESILVALPQKHRDSQG NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgctgctctgggtgttcttcatcatgatcctcaccctcagcaatggctcccacagctcc ccgccctccctgcccctcaggatgccccggtatgcagatgccatcttcaccaacggctac cggaaggtgctgggccaactgtctgcccgcaagctgctccaggacatcatgagcaggcag cagggagagagaaaccaggagcaaggagcaaaggtacggtctggccgtcaggtggacagc atgtgggcagaccgaaagcagatggcattggagagcatcctggtggccctgccacagaag cacagggattcccaaggatga

DBGET integrated database retrieval system