Pyricularia grisea: PgNI_03275 Help Entry PgNI_03275        CDS       T09406                                  Name (RefSeq) uncharacterized protein   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism pgri  Pyricularia grisea Pathway pgri03020   RNA polymerase pgri03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pgri00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     PgNI_03275   09124 Replication and repair    03420 Nucleotide excision repair     PgNI_03275  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pgri03021]     PgNI_03275    03400 DNA repair and recombination proteins [BR:pgri03400]     PgNI_03275 Transcription machinery [BR:pgri03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      PgNI_03275   RNA polymerase III system    RNA polymerase III      PgNI_03275   RNA polymerase I system    RNA polymerase I      PgNI_03275 DNA repair and recombination proteins [BR:pgri03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       PgNI_03275 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb8 RNA_pol_RpbG Motif Other DBs NCBI-GeneID:  41958240 NCBI-ProteinID:  XP_030983492 UniProt:  A0A6P8B8G6 LinkDB All DBs Position Unknown AA seq 155 aa AA seqDB search MAVATSDAQLFEGVFKVTEVNQQKYDRVARIWARSDASTDLMDMTLDINTELFPMSEGDV FRVVLATSLSLDGSKDDDKAGWRDATKLGGPATLADSFDYVCHGKIYKFEDSEDGDNIKA YISFGGLLMCLNGPYKKLTPLRVDYIYLLIKGNKD NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggctgttgcaacgagtgacgcgcagcttttcgagggtgtcttcaaggtcaccgaggtc aaccagcaaaagtacgaccgcgtggcgcgcatatgggcacgttccgatgcatcgacagac ctcatggacatgaccctcgacatcaacacagagctgttccccatgtcagagggtgacgtt ttccgcgtagtcttggccacgtctttgtcgctcgacggcagcaaggacgacgacaaggcc ggctggcgcgatgccaccaagctgggcggcccagcaaccctggccgacagcttcgactat gtttgccacggcaaaatatacaagtttgaggattctgaggacggtgacaatatcaaggcg tatatctccttcggtgggcttcttatgtgcctcaatggcccctacaagaagctcactcct ctacgggtggactacatttacttgctcatcaaaggaaacaaggactaa

DBGET integrated database retrieval system