Pantherophis guttatus (corn snake): 117664640 Help Entry 117664640         CDS       T07329                                  Symbol CXCL12 Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism pgut  Pantherophis guttatus (corn snake) Pathway pgut04060   Cytokine-cytokine receptor interaction pgut04672   Intestinal immune network for IgA production pgut04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:pgut00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     117664640 (CXCL12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     117664640 (CXCL12)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     117664640 (CXCL12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pgut04052]     117664640 (CXCL12)    00536 Glycosaminoglycan binding proteins [BR:pgut00536]     117664640 (CXCL12) Cytokines and neuropeptides [BR:pgut04052]  Cytokines   Chemokines    117664640 (CXCL12) Glycosaminoglycan binding proteins [BR:pgut00536]  Heparan sulfate / Heparin   Chemokines    117664640 (CXCL12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  117664640 NCBI-ProteinID:  XP_034271658 UniProt:  A0A6P9BLI8 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search MDRRPLALLLLLLLAALPGTRGKPISLTYRCPCRYFESHVAKSQLKHLKILTVPGCPLQV IARLKNSSKQICIDSKLKWIQEYLEKYFQKRVKM NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggaccgccgcccgctcgccctcctcctgctgctcctgctcgccgccctgcccggcacc cgcgggaaacccatcagcctgacttaccgctgcccttgtaggtattttgagagccacgtc gccaagtcccagctcaagcacctgaagatcttgaccgtccccggatgcccccttcaggtc attgcaagactgaaaaacagcagtaaacagatctgcatcgactccaagttaaagtggatt caagagtacctggagaaatactttcaaaagagagtcaagatgtaa

DBGET integrated database retrieval system