KEGG   Pantherophis guttatus (corn snake): 117674646
Entry
117674646         CDS       T07329                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
pgut  Pantherophis guttatus (corn snake)
SSDB
Motif
Pfam: MRAP
Other DBs
NCBI-GeneID: 117674646
NCBI-ProteinID: XP_034288698
UniProt: A0A6P9CXY6
LinkDB
Position
Unknown
AA seq 125 aa
MKIYLHNYSSASWEHCSFVLDLLRVQSYLGYTTEMTNSTNYTVHYEYYFDYFDLSPVDAS
KLKANRYSIIIGFWIGLVSFVAFLFFILFYISRSGTTSMKTGGSKKFPWNYSETIHQNLV
NNDTV
NT seq 378 nt   +upstreamnt  +downstreamnt
atgaaaatttatttgcacaattacagctcggcttcatgggaacactgtagttttgtgctg
gatctattaagagtccaaagctaccttggttatactactgaaatgaccaattcaacaaat
tatactgtgcactatgaatattactttgattactttgatctatctccagttgatgcaagt
aagctgaaagccaacagatattcaattatcataggcttttggattggacttgtttctttt
gtggcatttctcttctttattttgttctacatatctcgatctggtacaacatccatgaag
actggaggatcaaagaagtttccatggaattattcagaaactattcatcaaaatcttgtt
aacaatgacactgtatga

DBGET integrated database retrieval system