KEGG   Panicum hallii: 112903789
Entry
112903789         CDS       T07366                                 

Name
(RefSeq) P-(S)-hydroxymandelonitrile lyase-like
  KO
K08249  hydroxymandelonitrile lyase [EC:4.1.2.11]
Organism
phai  Panicum hallii
Pathway
phai00460  Cyanoamino acid metabolism
phai01100  Metabolic pathways
phai01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:phai00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    112903789
Enzymes [BR:phai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.11  hydroxymandelonitrile lyase
     112903789
SSDB
Motif
Pfam: Peptidase_S10
Other DBs
NCBI-GeneID: 112903789
NCBI-ProteinID: XP_025828780
LinkDB
Position
8:38985321..38987701
AA seq 496 aa
MARSSGHHRSPRRAAATPPLLALAAAGLLLLPLLARGSPEQQQLEDDRILGLPGQPNGVA
FGMYAGYVTVDEQAGRALYYWLQEADRDPGAAPLVLWLNGGPGCSSVGSGALEELGAFRV
HTDGETLLLNEYAWNKAANVLFLESPAGVGFSYSNTSSDVVMGDNRTAHDSYTFLVKWFE
RFPQYKYRDFYIIGESYGGHFVPQLSQLVHTNNIGVEKPVINFKGFMVGNGLINDHTDMT
GMFEYWWHHGLISDETLESGLKVCSETSFIHPSRECLEIWAGALEEQGNIDVYSIYTPPC
DKGSAFELRLKRSRRRAWMLPAYDPCVDFHATKYMNLPEVQKAMHANVTGSIEYPWSLCS
DPVYDNWPETPHSMLPIYKELIAAGLKVWVFSGDTDTVVPLTSTRRSLAALGLPVKTNWY
PWYMVPTEVGGWSMEYEGLTFVTIRGAGHAVPQHRPAQALVLFQHFLQGEPMPAEASSFA
FADTSNQLYLLKLTDN
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggctcgcagctccggccaccaccgctctccacggcgcgccgccgcgacgccgccgctc
ctcgcactagccgccgccggcctcctcctgctgccgctgctggcacgcgggtcccccgag
cagcagcagctcgaggacgaccggatcctggggctgccggggcagcccaacggcgtggcg
ttcggcatgtacgccggctacgtcacggtcgacgagcaggccggccgcgcgctctactac
tggctccaggaggccgaccgcgatccgggcgccgcgccgctcgtcctgtggctcaacggc
gggcccggctgctcctccgtcggctccggcgcgctcgaggagctcggcgcgttccgcgtc
cacaccgacggggagacgctcctgctcaacgagtacgcctggaacaaagcggcgaacgtg
ctgttcttggagtcgccggccggcgtggggttctcttacagcaacaccagctccgacgtg
gtcatgggcgacaacagaacagcgcatgactcgtatacgttcctggtgaaatggtttgag
agatttccacagtacaagtaccgcgatttctacattatcggagaaagttacggaggtcac
tttgttcctcagctctcgcagcttgtgcacacgaacaacatcggcgtggagaagcctgtc
atcaacttcaaaggtttcatggtcgggaacggtctgatcaacgaccacactgacatgacc
ggcatgttcgagtactggtggcaccacggcctcatctccgacgagaccctggagagcggg
ctcaaggtctgctccgagacctccttcatccacccctcgcgggagtgcctggagatatgg
gccggggccctcgaggagcaaggcaacatcgacgtctacagcatctacacgccaccatgc
gacaaggggagcgcattcgagctccgactcaagaggagccgccgccgcgcatggatgctg
cccgcgtatgacccgtgcgttgacttccacgcgaccaagtacatgaacctccccgaggtg
cagaaggccatgcacgccaacgtcacaggcagcatagagtacccatggagcttatgcagc
gatcccgtatatgataactggccagagacaccccattccatgctacccatctacaaggag
ctcattgcagctggcctcaaggtgtgggtcttcagtggtgacacggacactgtggtgccg
ctgacctcgaccaggcgctctcttgccgccctgggccttcctgtcaaaaccaactggtac
ccctggtacatggtcccaactgaggttggcggctggagcatggagtatgaaggcctgacc
ttcgtcaccatccgcggcgccgggcacgcggtcccccagcaccgcccggcgcaggcgctc
gtcctgttccagcacttcctgcagggcgaacccatgccggccgaggccagtagtttcgct
ttcgctgacacatcgaatcaactttatttgctgaagttgactgacaactga

DBGET integrated database retrieval system