Parasphingorhabdus halotolerans: HF685_02910 Help Entry HF685_02910       CDS       T07423                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism phao  Parasphingorhabdus halotolerans Pathway phao01100   Metabolic pathways phao01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:phao00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HF685_02910   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HF685_02910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  QJB68384 UniProt:  A0A6H2DJ78 LinkDB All DBs Position complement(606601..606837) Genome browser AA seq 78 aa AA seqDB search MSETADRVKKIVVEHLGVEADKVTEEAAFIDDLGADSLDIVELVMAFEEEFSVEIPDDAA EKIGTVKDAIDFIEKNKD NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgagactgcagaccgcgtaaaaaagattgttgttgagcatcttggtgtagaagcc gacaaagtgaccgaagaggccgcgttcattgatgatctgggcgcagacagcctcgatatt gtggagctcgtgatggcgttcgaagaagaattcagcgtggaaattcctgacgatgcagcg gaaaaaattggcaccgtcaaagacgcgattgatttcatcgagaaaaacaaagactga

DBGET integrated database retrieval system