KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102110596
Entry
102110596         CDS       T02921                                 
Symbol
TNFRSF8
Name
(RefSeq) TNF receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102110596 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:phi04050]
    102110596 (TNFRSF8)
   04090 CD molecules [BR:phi04090]
    102110596 (TNFRSF8)
Cytokine receptors [BR:phi04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102110596 (TNFRSF8)
CD molecules [BR:phi04090]
 Proteins
  102110596 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6 PA_decarbox
Other DBs
NCBI-GeneID: 102110596
NCBI-ProteinID: XP_014112706
LinkDB
Position
Un
AA seq 486 aa
MAACSLPLALGLLLLLQDIHTAPQTSLTPPHSCDTLENWFYDETSQNCCFQCPSGYVKKK
ACPRDPAEDCMTCGPDQYLNNVSPKPRCDACVSCSKDTDLVEKQPCSFNSSRTCECRPGL
FCRMTVENTCTRCQLHSACRPGFGVKIRGTSTNDVTCEECPPGTFSDQNSSTDTCKPHTN
CAKLNKVTLRKGNATHDQVCLDQLPTYLTPSTLSMRFSNETNNFDLRMFKENLVTSASGD
LLSVTTTENPSSTPEEKAQAGTSPTSAKGEMTTGGVVLWAVVLSVAVLLGGMLIFWKWKV
CKKRILVLRRKSHLDSVIAHKYTLKSQGSDLVNKCAKIVLTTDSGPEEEELINRALPLET
NNNLVSSTEKAQSPYWGVTDVTPSSGNAPDCPVDSRVRDHTNNRIEKLYIMKADTVIVGS
VSEVPSGKNCAVRGCESNLDAQESMEEELEMHYPEQETESFPGNDVMVPVEEEGKEFHHP
TTATEK
NT seq 1461 nt   +upstreamnt  +downstreamnt
atggctgcctgcagcctgcccctggcactggggctcctgctgctcctccaggacatccac
acagccccacagacatcattaaccccacctcattcctgtgacacactagagaattggttc
tatgatgaaacttcacaaaactgctgtttccagtgtccctcaggctatgttaaaaagaaa
gcatgtcctcgggatccagctgaagactgcatgacatgtggacctgatcaatatttgaac
aatgtgtccccaaagccacgatgtgatgcctgtgtgtcatgctcaaaagacacggacctg
gtggagaagcagccctgctccttcaactccagccgcacgtgcgagtgccggcccggcctg
ttctgcaggatgactgtcgagaacacctgcactcgctgccagctccactctgcttgcagg
cctggctttggagtcaaaatcaggggcacctcaacaaatgatgtcacttgtgaagagtgc
cctcctgggaccttctctgatcaaaactccagcacagacacctgcaaaccccacaccaac
tgtgccaagttgaacaaagtaacgctaaggaaaggaaatgccacacatgatcaagtttgc
ctggaccagctgcccacttacctcaccccaagcactttgtctatgagattcagcaatgaa
acaaataactttgacctgaggatgtttaaggagaacctggtgacctctgctagtggtgac
cttctaagtgtcacaacaactgaaaatcccagttcgacccctgaggagaaagcccaggct
ggcacttctcccacctcagctaagggggagatgacaacaggaggtgtagtgctgtgggca
gtggttctctctgtggcagtgcttcttgggggcatgctgatattttggaaatggaaggtt
tgcaagaagcggatcctcgtcctcagaagaaagtcacatctggactcggtcattgctcac
aaatacacgctcaaatctcaagggtcggatctcgtgaacaaatgtgcaaagatcgtactg
accactgacagtgggccagaagaggaggagttaattaacagagcccttcctttggaaacc
aacaataacttggtgtccagcacagaaaaagcacaaagtccttactggggtgtgactgat
gtgacaccaagcagtgggaatgccccagattgccctgtggattctcgagtcagagaccac
acaaataacagaattgaaaaactctacatcatgaaggccgacactgttatcgtggggtct
gtttcagaagtgcccagtggcaagaactgtgctgtcagaggatgtgaaagtaacctcgat
gcccaggaaagcatggaagaggaactggaaatgcattacccagagcaggaaacagagtct
tttccagggaatgatgtaatggttcctgtggaagaggagggaaaggaatttcaccacccc
accactgccactgagaaatga

DBGET integrated database retrieval system