KEGG   Pseudopodoces humilis (Tibetan ground-tit): 106628242
Entry
106628242         CDS       T02921                                 
Symbol
MRAP
Name
(RefSeq) melanocortin 2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
SSDB
Motif
Pfam: MRAP SelK_SelG
Other DBs
NCBI-GeneID: 106628242
NCBI-ProteinID: XP_014108966
LinkDB
Position
Un
AA seq 90 aa
MTNRTNSSEYFWSYEYYWDYIDPIPVDGSKLKVNKYSIVIAFWVGLAAFVTFLFLILLGM
SCSGSTPNTAVNGRAGSGRSSLGSDSTRAN
NT seq 273 nt   +upstreamnt  +downstreamnt
atgactaacagaacaaactcctctgagtatttctggtcttacgaatattactgggattac
atagatccaattccagtagatggaagcaagttgaaggttaataaatactccatcgtcatt
gccttttgggtcggccttgctgcatttgtgacgtttcttttccttattttactgggtatg
tcctgctctggatcaacgccaaacacggctgtgaacgggagagcggggtcgggcaggagt
tcattaggcagtgacagcactcgcgctaattaa

DBGET integrated database retrieval system