Phreatobacter cathodiphilus: C6569_07600 Help Entry C6569_07600       CDS       T05356                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism phr  Phreatobacter cathodiphilus Pathway phr02024   Quorum sensing phr03018   RNA degradation Brite KEGG Orthology (KO) [BR:phr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     C6569_07600  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     C6569_07600  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:phr03019]     C6569_07600    03036 Chromosome and associated proteins [BR:phr03036]     C6569_07600 Messenger RNA biogenesis [BR:phr03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      C6569_07600 Chromosome and associated proteins [BR:phr03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     C6569_07600 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 AcMNPV_AC11 Motif Other DBs NCBI-ProteinID:  AVO44937 UniProt:  A0A2S0NA97 LinkDB All DBs Position complement(1556999..1557250) Genome browser AA seq 83 aa AA seqDB search MAERAQNLQDTFLNHVRKHKIPLTIFLVNGVKLQGVVTWFDNFCVLLRRDGHSQLVYKHA ISTIMPGAPVQLFDPQDGDGDKG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggcggaacgagctcagaacctccaggacactttcctcaaccacgtccgcaagcataag attccgctgacgattttcctcgtcaacggcgtcaagctgcagggcgtcgtcacctggttc gacaatttctgtgtgctcctgcgtcgcgacggccactcgcaattggtctacaagcacgcc atatccacgatcatgcccggcgcgccggtccagctgttcgatccgcaggacggagacggc gacaagggctga

DBGET integrated database retrieval system