KEGG   Paraburkholderia hospita: C2L64_52615
Entry
C2L64_52615       CDS       T05305                                 
Name
(GenBank) chlorocatechol 1,2-dioxygenase
  KO
K15253  chlorocatechol 1,2-dioxygenase [EC:1.13.11.-]
Organism
phs  Paraburkholderia hospita
Pathway
phs00361  Chlorocyclohexane and chlorobenzene degradation
phs01100  Metabolic pathways
phs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:phs00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    C2L64_52615
Enzymes [BR:phs01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     C2L64_52615
SSDB
Motif
Pfam: Dioxygenase_C Dioxygenase_N DUF5706
Other DBs
NCBI-ProteinID: AUT76837
LinkDB
Position
pEMT1:18817..19584
AA seq 255 aa
MNKRVKDVVDAIVAAVQRVLDQKEVTEAEYRTAVHYLMQVAEQRETALLCDVFFNSTVAA
TKARISEGSTPAIEGPYYRDDAPLVDDRLKTYDTDDHKPLLIQGTVKAVDGSVVEDVTID
VWHSTPDGKYSGFHDDIPTDFYRGKLRVGTDGSFRVRTTMPVPYQIPDQGPTGALLETMG
GHSWRPAHVHFKVKAPGYETLTTQYYFEGGDWITDDCCNGVQSSLITPDIVEEGVRLMNI
NFVIEPARAQAGANP
NT seq 768 nt   +upstreamnt  +downstreamnt
gtgaacaaaagagtcaaggatgttgtcgatgcgatcgtcgcggcggtacagcgggtgctc
gaccagaaggaggttactgaggcggaataccgaactgcggttcattacctcatgcaagta
gccgaacagcgtgaaaccgctcttctttgcgatgtttttttcaatagcaccgtggctgcg
acgaaggctcgtattagcgaaggttcaacgcctgctatcgagggaccctactatcgcgac
gacgcccctctggtcgatgaccggctcaagacttacgacacggacgaccacaagcctttg
cttatccagggaacggtcaaagcggtcgacgggagcgttgtcgaggacgtgacgattgat
gtctggcattcgacgcccgatgggaagtacagcggtttccatgacgacatcccgactgat
ttttatcgagggaagctcagggtgggcaccgatggcagcttccgcgtgcgcacaacgatg
ccggtgccgtatcagatcccggatcagggtcccacgggcgcattgctcgaaaccatgggt
ggtcactcgtggcgtcccgctcatgtacatttcaaggtgaaggcgccgggatatgaaacg
ttgaccacgcagtactacttcgaaggtggagattggatcacggacgactgttgcaacggc
gtccagtctagtctgattactcccgatattgtggaagagggtgtccgcctgatgaacatc
aacttcgttatcgagcccgcgcgtgcgcaggcgggggcaaacccgtga

DBGET integrated database retrieval system