KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM319530
Entry
Phum_PHUM319530   CDS       T01223                                 
Name
(RefSeq) cytochrome P-450, putative
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    Phum_PHUM319530
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:phu00199]
    Phum_PHUM319530
Enzymes [BR:phu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     Phum_PHUM319530
Cytochrome P450 [BR:phu00199]
 Cytochrome P450, animal type
  CYP306 family
   Phum_PHUM319530
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 8236087
NCBI-ProteinID: XP_002427450
VectorBase: PHUM319530
UniProt: E0VMV6
LinkDB
AA seq 499 aa
MQVIEGLVGLLIGLIGYYLTRKIGKLMKKLPPGPYGLPIVGYLPFIDAKNPHYTLTKLSE
KYGKIYSIQMGNIFTVVLSDVKLVRQALAMDIFTGRAPLYLTHGIMKDNGIICVQGEKWK
EQRKFVVNNLRNFGMVKFATKKRDKMEEGIRCGVEELIKKIKTREGKPLNVEHLLMHTLG
NVVFNLVFGKVWNENDETWKKLINLQEEGTKLIGVAGPINFLPFLRFLPKYKKVIKYLKT
GIEYSHDIYQKILQEYKKNEKSMDDDNIEPEIDHFLGAFHWEMEKRKNEKSFYTNYQFNY
LMADLWGAGVDTTITTLRWFLFYVAHDDKIQKNIQNEIDEVLGDVKTVITLDDISSLPYF
QACISECQRIRSVTPLGIPHGSLEDAVLDGYHIPKGTMIIPLQWAIHMNSSYYNEPNVFD
PTRFLDDDGKYKKPEAFIPFQTGKRMCLGEEYAKMLLFLFAGAILNNFHLSLDYYEDFEG
EPGITLTPKKHLIIFTQRK
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgcaagtgatagaaggactcgtcggtttactcatcggcctcatcggttattatttgacg
cggaaaatcggaaaattaatgaaaaaattaccaccaggtccatacggtttacccatagtc
ggatatttaccatttattgatgctaaaaatcctcactacacgttaacgaaactatcggaa
aaatatggtaaaatatacagcatacaaatgggtaatatattcacagttgttttgtctgat
gtgaaactcgtacgtcaggcacttgccatggatatttttaccggaagagcacctctttat
ctaacacatggtataatgaaagataatggaataatatgcgttcaaggtgaaaaatggaaa
gagcaaaggaaatttgtcgttaataatttacgaaatttcggtatggttaaattcgcaacg
aaaaaacgggataaaatggaagaagggataagatgcggagtcgaggaattgataaaaaaa
ataaaaacccgcgaagggaaaccgttaaacgttgaacatttactcatgcacacactcggc
aacgttgtttttaatttagtctttggaaaagtctggaacgaaaatgacgaaacttggaaa
aagttaattaatctacaggaagagggtacgaaattaatcggcgttgccggaccgataaat
tttttaccctttctaagatttcttccaaaatataaaaaagtaataaaatatttaaaaact
ggaatcgaatacagtcatgatatatatcaaaaaatattacaagaatataaaaaaaatgaa
aaatctatggatgatgataatatcgaaccggaaattgatcattttttaggagctttccat
tgggaaatggaaaaaaggaaaaatgaaaaaagtttttacacaaattatcaatttaattat
ttaatggctgatttatggggagctggtgtcgacactacgataacgactttgagatggttt
ttattttacgttgcacacgacgacaaaatacagaaaaacattcaaaatgaaatagatgaa
gttttaggcgacgtgaaaaccgtcataactctcgatgatatttcatcccttccatacttt
caagcatgcatatcagaatgtcaaagaatccggtctgtcacacctttgggaataccacac
ggttcattggaggacgctgtattggacggataccacatacctaagggtaccatgattata
cctcttcagtgggccattcacatgaattcatcgtattataacgagccaaatgtttttgat
ccaacccggtttctggacgatgatggaaaatataaaaaaccagaagcattcatacccttt
cagaccggtaaaagaatgtgtttgggagaagaatatgctaaaatgttactttttcttttt
gccggtgccatattgaataattttcatttatctcttgattattatgaggatttcgagggt
gaacctggtatcacattaacgcccaaaaaacatttgattatatttacacaaaggaaataa

DBGET integrated database retrieval system