Phytophthora infestans: PITG_05864 Help Entry PITG_05864        CDS       T01333                                  Name (RefSeq) hypothetical protein   KO K12456   anaphase-promoting complex subunit 13 Organism pif  Phytophthora infestans Pathway pif04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:pif00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     PITG_05864  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pif04121]     PITG_05864    03036 Chromosome and associated proteins [BR:pif03036]     PITG_05864 Ubiquitin system [BR:pif04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    APC/C     Other subunits      PITG_05864 Chromosome and associated proteins [BR:pif03036]  Eukaryotic type   Sister chromatid separation proteins    APC/C complex     PITG_05864 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Apc13p Motif Other DBs NCBI-GeneID:  9472054 NCBI-ProteinID:  XP_002998100 UniProt:  D0N5V5 LinkDB All DBs AA seq 105 aa AA seqDB search MALGSSSGVKSSSSCTNWSLEILRAVTQSDSKLPSLFPRKHFLDIVDDDWITDTLSDDEI EVPPALDVDPNGSESPTGEPPMWTAGEKVDRWNDLGLDQWAKDSA NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggcgttggggtcttccagcggggtcaagagctcttcgtcctgcaccaattggagcttg gagatcctccgcgccgtgacgcaaagcgacagtaagctaccgagcttgttcccgcgcaag cacttcctggatatcgtggacgacgactggatcacggacacattgtcggacgatgagatc gaggtgcctcctgctctagatgtcgaccccaatggcagtgaaagcccaactggagagcct ccgatgtggactgcgggtgagaaggtggatcgctggaacgaccttggactcgaccagtgg gccaaagactctgcgtaa

DBGET integrated database retrieval system