KEGG   Pseudomonas knackmussii: PKB_3273
Entry
PKB_3273          CDS       T03081                                 
Symbol
clca1
Name
(GenBank) Chlorocatechol 1,2-dioxygenase
  KO
K15253  chlorocatechol 1,2-dioxygenase [EC:1.13.11.-]
Organism
pkc  Pseudomonas knackmussii
Pathway
pkc00361  Chlorocyclohexane and chlorobenzene degradation
pkc01100  Metabolic pathways
pkc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pkc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    PKB_3273 (clca1)
Enzymes [BR:pkc01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     PKB_3273 (clca1)
SSDB
Motif
Pfam: Dioxygenase_C Dioxygenase_N CarboxypepD_reg
Other DBs
NCBI-ProteinID: CDF84618
UniProt: A0A024HKI6
LinkDB
Position
3455677..3456459
AA seq 260 aa
MDKRVAEVAGAIVEAVRKILLDKRVTEAEYRAGVDYLTEVAQTRETALLLDVFLNSTIIE
GKAQRSRTSAPAIQGPYFLEGAPVVEGVLKTYDTDDHKPLIIRGTVRSDTGELLAGAVID
VWHSTPDGLYSGIHDNIPVDYYRGKLVTDSQGNYRVRTTMPVPYQIPYEGPTGRLLGHLG
SHTWRPAHVHFKVRKDGFEPLTTQYYFEGGKWVDDDCCHGVTPDLITPETIEDGVRVMTL
DFVIEREQAEQRKSATETVA
NT seq 783 nt   +upstreamnt  +downstreamnt
atggataaacgagttgccgaggtcgcaggcgcgatcgtcgaggcagtacgcaaaattttg
ctggacaagcgcgtcacggaagccgaataccgcgcgggtgtcgactatctcaccgaggtc
gcacagacgcgggaaaccgcgctgcttctggacgttttcctgaacagcaccatcatcgaa
ggcaaggcgcagcgctcgcggacctctgcgcctgcgatccaggggccgtacttcctggaa
ggtgctcctgtagttgaaggcgtcctcaagacctacgataccgacgaccacaaaccgctg
atcattcgcggtacggtgcgctcggacacgggcgagttgctcgctggcgctgtcatcgac
gtgtggcactcgacgcctgatggcttgtacagcgggatccacgacaacatccccgtggac
tactaccgcggaaaactcgtgacggattcccagggcaactatcgcgtgcgcaccacgatg
ccagtgccataccagatcccctacgaggggccgactgggcgtctgctgggccacctgggc
agccatacctggcgtccggcgcacgtgcacttcaaggtgcgcaaggacggtttcgaaccg
ttgaccacgcaatactacttcgaagggggcaaatgggtggacgatgactgctgtcacggc
gtcacccccgacctgattacgcccgagacgatcgaggacggggtgcgggtcatgaccctg
gacttcgtaatcgagcgtgagcaggccgagcaacgcaagtcggctacggagacagtggca
tga

DBGET integrated database retrieval system