Paraburkholderia kirstenboschensis: RW095_01280 Help Entry RW095_01280       CDS       T09457                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pkf  Paraburkholderia kirstenboschensis Pathway pkf02024   Quorum sensing pkf03018   RNA degradation Brite KEGG Orthology (KO) [BR:pkf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     RW095_01280 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     RW095_01280 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pkf03019]     RW095_01280 (hfq)    03036 Chromosome and associated proteins [BR:pkf03036]     RW095_01280 (hfq) Messenger RNA biogenesis [BR:pkf03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      RW095_01280 (hfq) Chromosome and associated proteins [BR:pkf03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     RW095_01280 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  WOD14182 UniProt:  A0ABZ0EDA6 LinkDB All DBs Position 3:complement(251815..252078) Genome browser AA seq 87 aa AA seqDB search MAALPDVQEIFLRVLIDDKAAVNVFLVNGIRLSGQLAAFDRFAVVLESASGSQLVFKHAI STVLPVNGRDLARGSGAAVSRDKPNNL NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggctgcattgccggacgtacaagaaatttttttgcgggtgctcatagacgacaaggcc gccgtaaacgtgttccttgtgaacggcatcaggctgagcggtcaactggccgcctttgac cgatttgcggttgtgttggagtctgcctcaggttcacaacttgttttcaaacatgccatc tcgaccgtgctgcctgtcaatggaagggacttggcacgcggttccggcgcggcggtgagt cgggacaagccgaacaacttgtga

DBGET integrated database retrieval system