Stutzerimonas kunmingensis: LW136_14730 Help Entry LW136_14730       CDS       T08242                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pkg  Stutzerimonas kunmingensis Pathway pkg01100   Metabolic pathways pkg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pkg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LW136_14730 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LW136_14730 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 TerB DUF1896 Ribosomal_L50 DUF1493 HLH Motif Other DBs NCBI-ProteinID:  UIP31398 LinkDB All DBs Position complement(3128287..3128523) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQEAIDYINAHAQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgttgccgagcaacttggcgttaaagaa gaggaagtaaccaacagcgcttccttcgtcgaagacctgggtgccgactctcttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgagatcccggacgagcaagct gagaagatcaccaccgttcaggaagccatcgattacatcaacgcgcacgcgcagtaa

DBGET integrated database retrieval system